BLASTX nr result
ID: Angelica23_contig00029213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00029213 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN36710.1| unknown [Zea mays] 59 3e-07 gb|AGG19203.1| glutamine synthetase [Vigna unguiculata] 55 8e-06 dbj|BAM84285.1| glutamine synthetase [Tulipa fosteriana] 55 8e-06 dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella] 55 8e-06 emb|CCO25538.1| glutamine synthetase [Pinus pinaster] 55 8e-06 >gb|ACN36710.1| unknown [Zea mays] Length = 217 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +1 Query: 1 AHYKACLYAGINISGINGEVMPGQVSLTFLRP 96 AHYKACLYAGINISGINGEVMPGQV T P Sbjct: 174 AHYKACLYAGINISGINGEVMPGQVGSTLYSP 205 >gb|AGG19203.1| glutamine synthetase [Vigna unguiculata] Length = 360 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 1 AHYKACLYAGINISGINGEVMPGQ 72 AHYKACLYAGINISGINGEVMPGQ Sbjct: 174 AHYKACLYAGINISGINGEVMPGQ 197 >dbj|BAM84285.1| glutamine synthetase [Tulipa fosteriana] Length = 353 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 1 AHYKACLYAGINISGINGEVMPGQ 72 AHYKACLYAGINISGINGEVMPGQ Sbjct: 174 AHYKACLYAGINISGINGEVMPGQ 197 >dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella] Length = 353 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 1 AHYKACLYAGINISGINGEVMPGQ 72 AHYKACLYAGINISGINGEVMPGQ Sbjct: 174 AHYKACLYAGINISGINGEVMPGQ 197 >emb|CCO25538.1| glutamine synthetase [Pinus pinaster] Length = 355 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 1 AHYKACLYAGINISGINGEVMPGQ 72 AHYKACLYAGINISGINGEVMPGQ Sbjct: 174 AHYKACLYAGINISGINGEVMPGQ 197