BLASTX nr result
ID: Angelica23_contig00029196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00029196 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863230.1| RNA recognition motif-containing protein [Ar... 83 2e-14 ref|NP_193001.2| RNA recognition motif (RRM)-containing protein ... 82 6e-14 dbj|BAF01596.1| hypothetical protein [Arabidopsis thaliana] 82 6e-14 dbj|BAF01027.1| hypothetical protein [Arabidopsis thaliana] 82 6e-14 gb|AAT41832.1| At4g12630 [Arabidopsis thaliana] 82 6e-14 >ref|XP_002863230.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309064|gb|EFH39489.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 817 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = +1 Query: 127 HLWVGSLAHDLSERTLREHLLRFGELQSVAFQPGRGYAFVNYKYEEDAFAAIRAL 291 HLWVG+L H + ER L + LRFGEL+S+AFQPGR YAFVN+K+ EDAFAAI +L Sbjct: 15 HLWVGNLPHGIPERELADRFLRFGELESLAFQPGRSYAFVNFKHNEDAFAAIESL 69 >ref|NP_193001.2| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana] gi|332657759|gb|AEE83159.1| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana] Length = 823 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 127 HLWVGSLAHDLSERTLREHLLRFGELQSVAFQPGRGYAFVNYKYEEDAFAAIRAL 291 HLWVG+L H + ER L + LRFGEL+S+AFQPGR YAFVN+ ++EDAFAAI +L Sbjct: 24 HLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESL 78 >dbj|BAF01596.1| hypothetical protein [Arabidopsis thaliana] Length = 823 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 127 HLWVGSLAHDLSERTLREHLLRFGELQSVAFQPGRGYAFVNYKYEEDAFAAIRAL 291 HLWVG+L H + ER L + LRFGEL+S+AFQPGR YAFVN+ ++EDAFAAI +L Sbjct: 24 HLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESL 78 >dbj|BAF01027.1| hypothetical protein [Arabidopsis thaliana] Length = 823 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 127 HLWVGSLAHDLSERTLREHLLRFGELQSVAFQPGRGYAFVNYKYEEDAFAAIRAL 291 HLWVG+L H + ER L + LRFGEL+S+AFQPGR YAFVN+ ++EDAFAAI +L Sbjct: 24 HLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESL 78 >gb|AAT41832.1| At4g12630 [Arabidopsis thaliana] Length = 117 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 127 HLWVGSLAHDLSERTLREHLLRFGELQSVAFQPGRGYAFVNYKYEEDAFAAIRAL 291 HLWVG+L H + ER L + LRFGEL+S+AFQPGR YAFVN+ ++EDAFAAI +L Sbjct: 24 HLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESL 78