BLASTX nr result
ID: Angelica23_contig00029080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00029080 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula] gi|3555... 63 2e-08 ref|XP_003633057.1| PREDICTED: regulatory protein NPR3 isoform 2... 62 5e-08 ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like [Gly... 62 5e-08 ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform 1... 62 5e-08 emb|CAN67078.1| hypothetical protein VITISV_004499 [Vitis vinifera] 62 5e-08 >ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula] gi|355518697|gb|AET00321.1| NPR1-1 protein [Medicago truncatula] Length = 594 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 286 NKLSASLEQLLLDSTSDYCDAEIVVEDIPIGIHRCILAA 402 NKLS SLE+LL D DYCDAEI+VE+IP+GIHRCILA+ Sbjct: 49 NKLSGSLEKLLSDVDYDYCDAEILVEEIPVGIHRCILAS 87 >ref|XP_003633057.1| PREDICTED: regulatory protein NPR3 isoform 2 [Vitis vinifera] Length = 599 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 286 NKLSASLEQLLLDSTSDYCDAEIVVEDIPIGIHRCILAA 402 +KLS++LEQLL+DS DY DAEI+VE IP+G+HRCILAA Sbjct: 46 SKLSSNLEQLLVDSGCDYSDAEIIVEGIPVGVHRCILAA 84 >ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like [Glycine max] Length = 590 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 286 NKLSASLEQLLLDSTSDYCDAEIVVEDIPIGIHRCILAA 402 NKLS SLE+LL+++ DY DAEI+VEDIP+GIHRCILA+ Sbjct: 45 NKLSGSLEKLLIETEYDYSDAEILVEDIPVGIHRCILAS 83 >ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform 1 [Vitis vinifera] Length = 587 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 286 NKLSASLEQLLLDSTSDYCDAEIVVEDIPIGIHRCILAA 402 +KLS++LEQLL+DS DY DAEI+VE IP+G+HRCILAA Sbjct: 46 SKLSSNLEQLLVDSGCDYSDAEIIVEGIPVGVHRCILAA 84 >emb|CAN67078.1| hypothetical protein VITISV_004499 [Vitis vinifera] Length = 628 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 286 NKLSASLEQLLLDSTSDYCDAEIVVEDIPIGIHRCILAA 402 +KLS++LEQLL+DS DY DAEI+VE IP+G+HRCILAA Sbjct: 46 SKLSSNLEQLLVDSGCDYSDAEIIVEGIPVGVHRCILAA 84