BLASTX nr result
ID: Angelica23_contig00028856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00028856 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543396.1| PREDICTED: uncharacterized protein LOC100814... 62 4e-08 ref|XP_003540266.1| PREDICTED: uncharacterized protein LOC100776... 59 3e-07 ref|XP_003596937.1| Kinesin-like protein [Medicago truncatula] g... 58 7e-07 ref|XP_002528807.1| kinesin, putative [Ricinus communis] gi|2235... 55 5e-06 ref|XP_002328088.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_003543396.1| PREDICTED: uncharacterized protein LOC100814373 [Glycine max] Length = 1342 Score = 62.4 bits (150), Expect = 4e-08 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = +1 Query: 154 MPFISEAASAIKSRFGFHDRNSEHNSIPIRSTPDLQKTASKQHLLHSSAIPNIASDKEDQ 333 MPF+SEAASAIKSRFGFHD SE S+ +++TPDL K+A K L SS + N+ SD +D+ Sbjct: 1 MPFLSEAASAIKSRFGFHDHPSESLSL-VQNTPDLFKSAVKDTLSQSSIVRNL-SDWDDE 58 >ref|XP_003540266.1| PREDICTED: uncharacterized protein LOC100776015 [Glycine max] Length = 1342 Score = 59.3 bits (142), Expect = 3e-07 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = +1 Query: 154 MPFISEAASAIKSRFGFHDRNSEHNSIPIRSTPDLQKTASKQHLLHSSAIPNIASDKEDQ 333 M F+SEAASAIKSRFGFHD SE S+ +++TPDL K+A K L SS + N+ SD +D+ Sbjct: 1 MAFLSEAASAIKSRFGFHDHPSESLSL-VQNTPDLFKSAVKDTLSQSSIVRNL-SDWDDE 58 >ref|XP_003596937.1| Kinesin-like protein [Medicago truncatula] gi|355485985|gb|AES67188.1| Kinesin-like protein [Medicago truncatula] Length = 1364 Score = 58.2 bits (139), Expect = 7e-07 Identities = 34/61 (55%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Frame = +1 Query: 154 MPFISEAASAIKSRFGFHDRNSEHNSIPIRSTPDLQKTASK-QHLLHSSAIPNIASDKED 330 MPF+SEAASAIK+RFGFH+ SE S+ I++TPDL K++ K +L SSA+ NI +D +D Sbjct: 1 MPFLSEAASAIKTRFGFHNHPSEQISL-IQNTPDLVKSSVKDNNLFQSSAVRNI-TDWDD 58 Query: 331 Q 333 + Sbjct: 59 E 59 >ref|XP_002528807.1| kinesin, putative [Ricinus communis] gi|223531760|gb|EEF33580.1| kinesin, putative [Ricinus communis] Length = 1381 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +1 Query: 154 MPFISEAASAIKSRFGFHDRNSEHNSIP--IRSTPDLQKTASKQHLLHSSAIPNIASDKE 327 MPFISEAASA+KSRFGFH+R+S S+P + STPDL + L+ +SA+ +I ++ Sbjct: 1 MPFISEAASALKSRFGFHNRSSSSESVPAAVPSTPDLLNYSVS--LVSTSAVRSIPDLED 58 Query: 328 D 330 D Sbjct: 59 D 59 >ref|XP_002328088.1| predicted protein [Populus trichocarpa] gi|222837603|gb|EEE75968.1| predicted protein [Populus trichocarpa] Length = 1197 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +1 Query: 154 MPFISEAASAIKSRFGFHDRNSEHNSIPIRSTPDLQKTASKQHLLHSS 297 MPF+S+ ASAIKSRFGFHDR S S+P STPDL K+ S+ H L S+ Sbjct: 1 MPFLSDTASAIKSRFGFHDR-SVSESVP--STPDLLKSVSRDHNLASA 45