BLASTX nr result
ID: Angelica23_contig00028528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00028528 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531635.1| alpha-glucosidase, putative [Ricinus communi... 98 6e-19 emb|CAA10382.2| alpha-D-xylosidase [Tropaeolum majus] 95 7e-18 ref|XP_002311455.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 emb|CAB96077.1| alpha-glucosidase [Solanum tuberosum] 89 3e-16 ref|XP_002315944.1| predicted protein [Populus trichocarpa] gi|2... 88 8e-16 >ref|XP_002531635.1| alpha-glucosidase, putative [Ricinus communis] gi|223528753|gb|EEF30763.1| alpha-glucosidase, putative [Ricinus communis] Length = 930 Score = 98.2 bits (243), Expect = 6e-19 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +1 Query: 115 NGSASTPTAPPKIGKGYRLISVAESPDGGLIGHLQVKQKNNIYGPDIPLLQLYVKHET 288 + S+S + P KIGKGYRLI+V E+PDGG++GHLQVKQKNNIYGPDIPLLQLYVKHET Sbjct: 23 SSSSSKSSKPIKIGKGYRLIAVEETPDGGILGHLQVKQKNNIYGPDIPLLQLYVKHET 80 >emb|CAA10382.2| alpha-D-xylosidase [Tropaeolum majus] Length = 935 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 124 ASTPTAPPKIGKGYRLISVAESPDGGLIGHLQVKQKNNIYGPDIPLLQLYVKHET 288 +STP AP KIGKGYRLIS+ E+PDGG +GHLQVKQ N IYG DIPLLQLYVKHE+ Sbjct: 32 SSTPAAPTKIGKGYRLISIEETPDGGFLGHLQVKQPNKIYGADIPLLQLYVKHES 86 >ref|XP_002311455.1| predicted protein [Populus trichocarpa] gi|222851275|gb|EEE88822.1| predicted protein [Populus trichocarpa] Length = 910 Score = 91.7 bits (226), Expect = 6e-17 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = +1 Query: 112 TNGSASTPTAPPKIGKGYRLISVAESPDGGLIGHLQVKQKNNIYGPDIPLLQLYVKHET 288 T S+STPT KIGKGYRLIS+ E+PDGG++G LQVKQ N IYGPDIPLLQLYVKHET Sbjct: 5 TVNSSSTPT---KIGKGYRLISIEETPDGGIVGILQVKQNNKIYGPDIPLLQLYVKHET 60 >emb|CAB96077.1| alpha-glucosidase [Solanum tuberosum] Length = 928 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 136 TAPPKIGKGYRLISVAESPDGGLIGHLQVKQKNNIYGPDIPLLQLYVKHET 288 TAP KIG GY LI++ ESPDGGLIG+L+VK+KNNIYGPDIP LQLYVKHET Sbjct: 26 TAPTKIGNGYSLIAIEESPDGGLIGYLKVKKKNNIYGPDIPNLQLYVKHET 76 >ref|XP_002315944.1| predicted protein [Populus trichocarpa] gi|222864984|gb|EEF02115.1| predicted protein [Populus trichocarpa] Length = 928 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = +1 Query: 106 YYTNGSASTPTAPPKIGKGYRLISVAESPDGGLIGHLQVKQKNNIYGPDIPLLQLYVKHE 285 ++ S+STPT KIG GYRLIS+ E+PDGG+ G LQVK++NNIYGPDIPLLQLYVKHE Sbjct: 20 FHLVNSSSTPT---KIGNGYRLISLKETPDGGIGGLLQVKERNNIYGPDIPLLQLYVKHE 76 Query: 286 T 288 T Sbjct: 77 T 77