BLASTX nr result
ID: Angelica23_contig00028425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00028425 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517005.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 ref|XP_003590109.1| hypothetical protein MTR_1g044470 [Medicago ... 64 2e-08 ref|XP_002332028.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002319090.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002517005.1| conserved hypothetical protein [Ricinus communis] gi|223543640|gb|EEF45168.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 75.9 bits (185), Expect = 3e-12 Identities = 44/96 (45%), Positives = 60/96 (62%), Gaps = 6/96 (6%) Frame = -1 Query: 302 IVSIILGMLLLL--HYNQFQVCKGGRILNEKP---SVGLQSLERGPVPPSGPSGCTNIPE 138 ++SI L LLLL H Q+Q RIL ++ +G+QSL+RG P +G SGCTNIP Sbjct: 4 LLSIALAALLLLSFHVQQYQA---SRILYDQDVNKELGVQSLQRGDTPSTGASGCTNIPN 60 Query: 137 SSGTKCP-MIGEMHVAGPGMAQSSAYPNVLVPFSVA 33 + G CP +I M+VAG G++ +SAYP + V F A Sbjct: 61 TGGPSCPSVINSMNVAGNGLSHASAYPRLTVEFGAA 96 >ref|XP_003590109.1| hypothetical protein MTR_1g044470 [Medicago truncatula] gi|355479157|gb|AES60360.1| hypothetical protein MTR_1g044470 [Medicago truncatula] Length = 83 Score = 63.5 bits (153), Expect = 2e-08 Identities = 38/73 (52%), Positives = 48/73 (65%) Frame = -1 Query: 308 RIIVSIILGMLLLLHYNQFQVCKGGRILNEKPSVGLQSLERGPVPPSGPSGCTNIPESSG 129 R + +I+L LLLL + G R+LN K + LQ+L++GPV PSGPSGCT IP S G Sbjct: 2 RALNNIVLVFLLLLTIIHVRPNLGVRVLNMK-ELRLQALDKGPVAPSGPSGCTFIPGSGG 60 Query: 128 TKCPMIGEMHVAG 90 T CP I E +VAG Sbjct: 61 THCP-IEERNVAG 72 >ref|XP_002332028.1| predicted protein [Populus trichocarpa] gi|222875253|gb|EEF12384.1| predicted protein [Populus trichocarpa] Length = 105 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -1 Query: 203 LQSLERGPVPPSGPSGCTNIPESSGTKCPMIGEMHVAGPGMAQS-SAYPNVLVPFSVAT 30 +QSL RGP+PPSG S CT+IP CP +GEM+ AG +A + A+P+ +V F+ A+ Sbjct: 35 IQSLRRGPIPPSGGSSCTHIPGRGSGHCP-LGEMNFAGHIVAHAPPAFPDAIVKFAAAS 92 >ref|XP_002319090.1| predicted protein [Populus trichocarpa] gi|222857466|gb|EEE95013.1| predicted protein [Populus trichocarpa] Length = 116 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -1 Query: 236 GRILNEKPSVGLQSLERGPVPPSGPSGCTNIPESSGTKCPMIGEMHVAGPGMAQS-SAYP 60 G +EK +QSL+RGPVPPSG S CT+IP KC +GEM+ AG +A + A+P Sbjct: 35 GERWSEKIVGNIQSLQRGPVPPSGGSPCTHIPGRGSGKC-SLGEMNFAGHTVALAPPAFP 93 Query: 59 NVLVPFSVA 33 + ++ F A Sbjct: 94 DAIMNFGAA 102