BLASTX nr result
ID: Angelica23_contig00028406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00028406 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV17668.1| hypothetical protein GTCCBUS3UF5_3420 [Geobacillu... 99 4e-19 gb|AEV17416.1| hypothetical protein GTCCBUS3UF5_870 [Geobacillus... 99 4e-19 gb|AEV17354.1| hypothetical protein GTCCBUS3UF5_250 [Geobacillus... 99 4e-19 gb|AEV17926.1| hypothetical protein GTCCBUS3UF5_6030 [Geobacillu... 86 4e-15 gb|AEV17339.1| hypothetical protein GTCCBUS3UF5_100 [Geobacillus... 86 4e-15 >gb|AEV17668.1| hypothetical protein GTCCBUS3UF5_3420 [Geobacillus thermoleovorans CCB_US3_UF5] Length = 236 Score = 99.0 bits (245), Expect = 4e-19 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +3 Query: 30 LISSPPGT*MFQFPGYALHTL*IHAWILPHYGQWVPPFGNLRINAYLQLPEAYRCL 197 L+SSPPGT MFQFPG ALH L I AWILPHYGQWVPPFG+LRINA LQLPEA+R L Sbjct: 82 LLSSPPGTKMFQFPGCALHALWIQAWILPHYGQWVPPFGHLRINACLQLPEAFRRL 137 >gb|AEV17416.1| hypothetical protein GTCCBUS3UF5_870 [Geobacillus thermoleovorans CCB_US3_UF5] Length = 101 Score = 99.0 bits (245), Expect = 4e-19 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +3 Query: 30 LISSPPGT*MFQFPGYALHTL*IHAWILPHYGQWVPPFGNLRINAYLQLPEAYRCL 197 L+SSPPGT MFQFPG ALH L I AWILPHYGQWVPPFG+LRINA LQLPEA+R L Sbjct: 29 LLSSPPGTKMFQFPGCALHALWIQAWILPHYGQWVPPFGHLRINACLQLPEAFRRL 84 >gb|AEV17354.1| hypothetical protein GTCCBUS3UF5_250 [Geobacillus thermoleovorans CCB_US3_UF5] Length = 292 Score = 99.0 bits (245), Expect = 4e-19 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +3 Query: 30 LISSPPGT*MFQFPGYALHTL*IHAWILPHYGQWVPPFGNLRINAYLQLPEAYRCL 197 L+SSPPGT MFQFPG ALH L I AWILPHYGQWVPPFG+LRINA LQLPEA+R L Sbjct: 82 LLSSPPGTKMFQFPGCALHALWIQAWILPHYGQWVPPFGHLRINACLQLPEAFRRL 137 >gb|AEV17926.1| hypothetical protein GTCCBUS3UF5_6030 [Geobacillus thermoleovorans CCB_US3_UF5] Length = 64 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +3 Query: 57 MFQFPGYALHTL*IHAWILPHYGQWVPPFGNLRINAYLQLPEAYRCL 197 MFQFPG ALH L I AWILPHYGQWVPPFG+LRINA LQLPEA+R L Sbjct: 1 MFQFPGCALHALWIQAWILPHYGQWVPPFGHLRINACLQLPEAFRRL 47 >gb|AEV17339.1| hypothetical protein GTCCBUS3UF5_100 [Geobacillus thermoleovorans CCB_US3_UF5] Length = 114 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +3 Query: 57 MFQFPGYALHTL*IHAWILPHYGQWVPPFGNLRINAYLQLPEAYRCL 197 MFQFPG ALH L I AWILPHYGQWVPPFG+LRINA LQLPEA+R L Sbjct: 1 MFQFPGCALHALWIQAWILPHYGQWVPPFGHLRINACLQLPEAFRRL 47