BLASTX nr result
ID: Angelica23_contig00028168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00028168 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632624.1| PREDICTED: exportin-7-like isoform 2 [Vitis ... 159 2e-37 ref|XP_002284048.2| PREDICTED: exportin-7-like isoform 1 [Vitis ... 159 2e-37 emb|CBI32875.3| unnamed protein product [Vitis vinifera] 159 2e-37 ref|NP_196230.2| armadillo/beta-catenin-like repeat-containing p... 158 5e-37 ref|NP_001190236.1| armadillo/beta-catenin-like repeat-containin... 158 5e-37 >ref|XP_003632624.1| PREDICTED: exportin-7-like isoform 2 [Vitis vinifera] Length = 1052 Score = 159 bits (403), Expect = 2e-37 Identities = 76/99 (76%), Positives = 91/99 (91%) Frame = -2 Query: 298 MENLAQLESLCERLYKSKDSVERSHAENALRCFSVDSNYILQCQYVLENASTPYALMMAS 119 ME LAQLE+LCERLY S DS ER+HAE+ L+CFSV+++YI QCQY+L+NASTPYAL++AS Sbjct: 1 MECLAQLEALCERLYNSLDSAERAHAESTLKCFSVNTDYISQCQYILDNASTPYALLLAS 60 Query: 118 SSLLKQVTDHRLPLQLRLDIRNYILSYLATRGPKLENFV 2 SSLLKQVT+H+LPLQLRLDIRNYI++YLATRGP LE FV Sbjct: 61 SSLLKQVTEHKLPLQLRLDIRNYIINYLATRGPDLEPFV 99 >ref|XP_002284048.2| PREDICTED: exportin-7-like isoform 1 [Vitis vinifera] Length = 1053 Score = 159 bits (403), Expect = 2e-37 Identities = 76/99 (76%), Positives = 91/99 (91%) Frame = -2 Query: 298 MENLAQLESLCERLYKSKDSVERSHAENALRCFSVDSNYILQCQYVLENASTPYALMMAS 119 ME LAQLE+LCERLY S DS ER+HAE+ L+CFSV+++YI QCQY+L+NASTPYAL++AS Sbjct: 1 MECLAQLEALCERLYNSLDSAERAHAESTLKCFSVNTDYISQCQYILDNASTPYALLLAS 60 Query: 118 SSLLKQVTDHRLPLQLRLDIRNYILSYLATRGPKLENFV 2 SSLLKQVT+H+LPLQLRLDIRNYI++YLATRGP LE FV Sbjct: 61 SSLLKQVTEHKLPLQLRLDIRNYIINYLATRGPDLEPFV 99 >emb|CBI32875.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 159 bits (403), Expect = 2e-37 Identities = 76/99 (76%), Positives = 91/99 (91%) Frame = -2 Query: 298 MENLAQLESLCERLYKSKDSVERSHAENALRCFSVDSNYILQCQYVLENASTPYALMMAS 119 ME LAQLE+LCERLY S DS ER+HAE+ L+CFSV+++YI QCQY+L+NASTPYAL++AS Sbjct: 1 MECLAQLEALCERLYNSLDSAERAHAESTLKCFSVNTDYISQCQYILDNASTPYALLLAS 60 Query: 118 SSLLKQVTDHRLPLQLRLDIRNYILSYLATRGPKLENFV 2 SSLLKQVT+H+LPLQLRLDIRNYI++YLATRGP LE FV Sbjct: 61 SSLLKQVTEHKLPLQLRLDIRNYIINYLATRGPDLEPFV 99 >ref|NP_196230.2| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332003586|gb|AED90969.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 1066 Score = 158 bits (399), Expect = 5e-37 Identities = 73/99 (73%), Positives = 92/99 (92%) Frame = -2 Query: 298 MENLAQLESLCERLYKSKDSVERSHAENALRCFSVDSNYILQCQYVLENASTPYALMMAS 119 ME+LAQLE++CERLY S+DS ER+HAEN+LRCFSV+++YI QCQY+L+N+S PY+LM+AS Sbjct: 9 MESLAQLEAMCERLYNSQDSAERAHAENSLRCFSVNTDYISQCQYILDNSSKPYSLMLAS 68 Query: 118 SSLLKQVTDHRLPLQLRLDIRNYILSYLATRGPKLENFV 2 SSLLKQVTDH LPL LRLDIR YI++YLATRGPK+++FV Sbjct: 69 SSLLKQVTDHTLPLNLRLDIRAYIVNYLATRGPKMQSFV 107 >ref|NP_001190236.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|334187454|ref|NP_001190237.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332003588|gb|AED90971.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332003589|gb|AED90972.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 1052 Score = 158 bits (399), Expect = 5e-37 Identities = 73/99 (73%), Positives = 92/99 (92%) Frame = -2 Query: 298 MENLAQLESLCERLYKSKDSVERSHAENALRCFSVDSNYILQCQYVLENASTPYALMMAS 119 ME+LAQLE++CERLY S+DS ER+HAEN+LRCFSV+++YI QCQY+L+N+S PY+LM+AS Sbjct: 1 MESLAQLEAMCERLYNSQDSAERAHAENSLRCFSVNTDYISQCQYILDNSSKPYSLMLAS 60 Query: 118 SSLLKQVTDHRLPLQLRLDIRNYILSYLATRGPKLENFV 2 SSLLKQVTDH LPL LRLDIR YI++YLATRGPK+++FV Sbjct: 61 SSLLKQVTDHTLPLNLRLDIRAYIVNYLATRGPKMQSFV 99