BLASTX nr result
ID: Angelica23_contig00027450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00027450 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR16789.1| unknown [Picea sitchensis] 79 4e-13 ref|XP_002892891.1| hypothetical protein ARALYDRAFT_471800 [Arab... 72 4e-11 ref|NP_563988.1| magnesium transporter MRS2-1 [Arabidopsis thali... 72 4e-11 emb|CBI25190.3| unnamed protein product [Vitis vinifera] 70 1e-10 ref|XP_002263392.1| PREDICTED: magnesium transporter MRS2-1-like... 70 1e-10 >gb|ABR16789.1| unknown [Picea sitchensis] Length = 467 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 260 IQMFNYPKAFKWVLIITGVTGFVIFYSFLWFFKHRRLMPL 141 I +F+ PKAFKWVLIITGVTGF+IF+SFLWFFKHRRLMPL Sbjct: 428 IDLFDEPKAFKWVLIITGVTGFIIFFSFLWFFKHRRLMPL 467 >ref|XP_002892891.1| hypothetical protein ARALYDRAFT_471800 [Arabidopsis lyrata subsp. lyrata] gi|297338733|gb|EFH69150.1| hypothetical protein ARALYDRAFT_471800 [Arabidopsis lyrata subsp. lyrata] Length = 443 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 266 FEIQMFNYPKAFKWVLIITGVTGFVIFYSFLWFFKHRRLMPL 141 FEI FN P AF+WVLIITGV GFVIF +F+WFFK+RRLMPL Sbjct: 402 FEIDFFNQPGAFRWVLIITGVCGFVIFSAFVWFFKYRRLMPL 443 >ref|NP_563988.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|145323912|ref|NP_001077545.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|334182607|ref|NP_001185007.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|75199341|sp|Q9S9N4.1|MRS21_ARATH RecName: Full=Magnesium transporter MRS2-1; AltName: Full=Magnesium Transporter 2; Short=AtMGT2 gi|6587806|gb|AAF18497.1|AC010924_10 Contains similarity to gb|M82916 MRS2 protein from Saccharomyces cerivisae. ESTs gb|N96043, gb|AI998651, gb|AA585850, gb|T42027 come from this gene [Arabidopsis thaliana] gi|10880269|emb|CAC13981.1| putative magnesium transporter [Arabidopsis thaliana] gi|15451154|gb|AAK96848.1| Unknown protein [Arabidopsis thaliana] gi|20148403|gb|AAM10092.1| unknown protein [Arabidopsis thaliana] gi|25360797|gb|AAN73211.1| MRS2-1 [Arabidopsis thaliana] gi|227204423|dbj|BAH57063.1| AT1G16010 [Arabidopsis thaliana] gi|227206182|dbj|BAH57146.1| AT1G16010 [Arabidopsis thaliana] gi|332191274|gb|AEE29395.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|332191275|gb|AEE29396.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|332191276|gb|AEE29397.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] Length = 442 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 266 FEIQMFNYPKAFKWVLIITGVTGFVIFYSFLWFFKHRRLMPL 141 FEI FN P AF+WVLIITGV GFVIF +F+WFFK+RRLMPL Sbjct: 401 FEIDFFNQPGAFRWVLIITGVCGFVIFSAFVWFFKYRRLMPL 442 >emb|CBI25190.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 266 FEIQMFNYPKAFKWVLIITGVTGFVIFYSFLWFFKHRRLMPL 141 FEI MF+ P AFKWVLIITG+ G +IF SF+WFFK+RRLMPL Sbjct: 313 FEIPMFDDPGAFKWVLIITGICGIIIFCSFVWFFKYRRLMPL 354 >ref|XP_002263392.1| PREDICTED: magnesium transporter MRS2-1-like [Vitis vinifera] Length = 444 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 266 FEIQMFNYPKAFKWVLIITGVTGFVIFYSFLWFFKHRRLMPL 141 FEI MF+ P AFKWVLIITG+ G +IF SF+WFFK+RRLMPL Sbjct: 403 FEIPMFDDPGAFKWVLIITGICGIIIFCSFVWFFKYRRLMPL 444