BLASTX nr result
ID: Angelica23_contig00027171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00027171 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263812.1| PREDICTED: C-type lectin receptor-like tyros... 71 1e-10 ref|XP_002519359.1| kinase, putative [Ricinus communis] gi|22354... 71 1e-10 ref|XP_002326442.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_004161974.1| PREDICTED: C-type lectin receptor-like tyros... 70 2e-10 ref|XP_004145205.1| PREDICTED: C-type lectin receptor-like tyros... 70 2e-10 >ref|XP_002263812.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Vitis vinifera] Length = 542 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 273 VIQKVVDLVYSCTQHVPSMRPRMSHVVHQLQQLA 172 VIQKVVDLVY+CTQHVPSMRPRMSHVVHQLQQLA Sbjct: 503 VIQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA 536 >ref|XP_002519359.1| kinase, putative [Ricinus communis] gi|223541426|gb|EEF42976.1| kinase, putative [Ricinus communis] Length = 552 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 273 VIQKVVDLVYSCTQHVPSMRPRMSHVVHQLQQLA 172 VIQKVVDLVY+CTQHVPSMRPRMSHVVHQLQQLA Sbjct: 513 VIQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA 546 >ref|XP_002326442.1| predicted protein [Populus trichocarpa] gi|222833764|gb|EEE72241.1| predicted protein [Populus trichocarpa] Length = 516 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 273 VIQKVVDLVYSCTQHVPSMRPRMSHVVHQLQQLA 172 VIQKVVDLVY+CTQHVPSMRPRMSHVVHQLQQLA Sbjct: 481 VIQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA 514 >ref|XP_004161974.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Cucumis sativus] Length = 557 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 273 VIQKVVDLVYSCTQHVPSMRPRMSHVVHQLQQLA 172 ++QKVVDLVY+CTQHVPSMRPRMSHVVHQLQQLA Sbjct: 517 IVQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA 550 >ref|XP_004145205.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Cucumis sativus] gi|449473071|ref|XP_004153775.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Cucumis sativus] Length = 557 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 273 VIQKVVDLVYSCTQHVPSMRPRMSHVVHQLQQLA 172 ++QKVVDLVY+CTQHVPSMRPRMSHVVHQLQQLA Sbjct: 517 IVQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA 550