BLASTX nr result
ID: Angelica23_contig00027048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00027048 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634048.1| PREDICTED: pectinesterase 2-like isoform 2 [... 90 2e-16 emb|CBI24582.3| unnamed protein product [Vitis vinifera] 90 2e-16 ref|XP_002265104.1| PREDICTED: pectinesterase 2-like isoform 1 [... 90 2e-16 ref|XP_002318285.1| predicted protein [Populus trichocarpa] gi|2... 89 3e-16 ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinu... 86 2e-15 >ref|XP_003634048.1| PREDICTED: pectinesterase 2-like isoform 2 [Vitis vinifera] Length = 520 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -1 Query: 364 GPGSSTGGRVKWRGYRVITSVSEASKFSVANFIAGKSWLPATNVPFTS 221 GPGSST GRVKWRGYRVITS +EASKFSVANFIAG+SWLPAT VPF S Sbjct: 471 GPGSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRS 518 >emb|CBI24582.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -1 Query: 364 GPGSSTGGRVKWRGYRVITSVSEASKFSVANFIAGKSWLPATNVPFTS 221 GPGSST GRVKWRGYRVITS +EASKFSVANFIAG+SWLPAT VPF S Sbjct: 211 GPGSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRS 258 >ref|XP_002265104.1| PREDICTED: pectinesterase 2-like isoform 1 [Vitis vinifera] Length = 494 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -1 Query: 364 GPGSSTGGRVKWRGYRVITSVSEASKFSVANFIAGKSWLPATNVPFTS 221 GPGSST GRVKWRGYRVITS +EASKFSVANFIAG+SWLPAT VPF S Sbjct: 445 GPGSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRS 492 >ref|XP_002318285.1| predicted protein [Populus trichocarpa] gi|222858958|gb|EEE96505.1| predicted protein [Populus trichocarpa] Length = 520 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 367 SGPGSSTGGRVKWRGYRVITSVSEASKFSVANFIAGKSWLPATNVPFTS 221 SGPG+ST GRVKWRGYRVITS +EAS+F+VANFIAG+SWLPAT VPF+S Sbjct: 470 SGPGASTSGRVKWRGYRVITSATEASRFTVANFIAGRSWLPATGVPFSS 518 >ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis] gi|223550055|gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis] Length = 455 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 364 GPGSSTGGRVKWRGYRVITSVSEASKFSVANFIAGKSWLPATNVPFTS 221 GP SST GRVKWRGYRVITS +EAS+F+VANFIAG+SWLPAT VPF+S Sbjct: 406 GPASSTSGRVKWRGYRVITSATEASQFTVANFIAGRSWLPATGVPFSS 453