BLASTX nr result
ID: Angelica23_contig00026912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00026912 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280621.2| PREDICTED: uncharacterized protein LOC100245... 67 2e-09 emb|CBI26910.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002526016.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|NP_177251.2| TPX2 (targeting protein for Xklp2) protein fami... 59 4e-07 ref|XP_002887339.1| hypothetical protein ARALYDRAFT_894920 [Arab... 57 1e-06 >ref|XP_002280621.2| PREDICTED: uncharacterized protein LOC100245710 [Vitis vinifera] Length = 452 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 107 IEDPFQLSFKADSLHSGSISFGRFETESLSWERKS 3 IE+PF L+F+ADSLHSGSISFGRFETESLSWER+S Sbjct: 47 IEEPFSLNFQADSLHSGSISFGRFETESLSWERRS 81 >emb|CBI26910.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 107 IEDPFQLSFKADSLHSGSISFGRFETESLSWERKS 3 IE+PF L+F+ADSLHSGSISFGRFETESLSWER+S Sbjct: 5 IEEPFSLNFQADSLHSGSISFGRFETESLSWERRS 39 >ref|XP_002526016.1| conserved hypothetical protein [Ricinus communis] gi|223534663|gb|EEF36356.1| conserved hypothetical protein [Ricinus communis] Length = 639 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 104 EDPFQLSFKADSLHSGSISFGRFETESLSWERKS 3 E+P+ +SF+ DSLHSGSISFGRFE+E+LSWER+S Sbjct: 6 EEPYSISFQTDSLHSGSISFGRFESENLSWERRS 39 >ref|NP_177251.2| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis thaliana] gi|51971395|dbj|BAD44362.1| At1g70950 [Arabidopsis thaliana] gi|332197022|gb|AEE35143.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis thaliana] Length = 478 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 107 IEDPFQLSFKADSLHSGSISFGRFETESLSWERKS 3 I+DPF LSF+ +S+HSGSISFGRFE E LSWE++S Sbjct: 5 IQDPFSLSFQGNSIHSGSISFGRFEKEGLSWEKRS 39 >ref|XP_002887339.1| hypothetical protein ARALYDRAFT_894920 [Arabidopsis lyrata subsp. lyrata] gi|297333180|gb|EFH63598.1| hypothetical protein ARALYDRAFT_894920 [Arabidopsis lyrata subsp. lyrata] Length = 479 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 107 IEDPFQLSFKADSLHSGSISFGRFETESLSWERKS 3 I++PF LSF+ +S+HSGSISFGRFE E LSWE++S Sbjct: 5 IQEPFSLSFQGNSIHSGSISFGRFEKEGLSWEKRS 39