BLASTX nr result
ID: Angelica23_contig00026547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00026547 (534 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632735.1| PREDICTED: uncharacterized protein At5g39865... 55 4e-13 ref|XP_002529166.1| electron transporter, putative [Ricinus comm... 50 3e-12 ref|XP_002308899.1| hypothetical protein POPTRDRAFT_416706 [Popu... 52 4e-12 ref|XP_003554133.1| PREDICTED: uncharacterized protein At5g39865... 48 3e-11 ref|XP_002323258.1| hypothetical protein POPTRDRAFT_255411 [Popu... 50 4e-11 >ref|XP_003632735.1| PREDICTED: uncharacterized protein At5g39865-like [Vitis vinifera] Length = 393 Score = 55.1 bits (131), Expect(2) = 4e-13 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 300 VLVDERDVSMDSKYRKDLQSVFEGKRFSLPQVFV 199 V+VDERD+SMDS YRK+LQ+VF GK SLPQVF+ Sbjct: 277 VMVDERDISMDSNYRKELQNVFGGKVVSLPQVFI 310 Score = 44.3 bits (103), Expect(2) = 4e-13 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 403 KDMIVLYFTNMRGIRKTCEDCCQVR 329 +D +VLYFT++RGIRKT EDCC VR Sbjct: 245 EDRVVLYFTSLRGIRKTYEDCCAVR 269 >ref|XP_002529166.1| electron transporter, putative [Ricinus communis] gi|223531390|gb|EEF33225.1| electron transporter, putative [Ricinus communis] Length = 424 Score = 50.1 bits (118), Expect(2) = 3e-12 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -1 Query: 300 VLVDERDVSMDSKYRKDLQSVFEGKRFSLPQVFV 199 V VDE+D+SMDS YRK+LQS+ +GK LPQVF+ Sbjct: 305 VPVDEKDISMDSSYRKELQSMLKGKAMCLPQVFI 338 Score = 46.2 bits (108), Expect(2) = 3e-12 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 412 NYKKDMIVLYFTNMRGIRKTCEDCCQVR 329 N + D IVLYFT++RGIRKT EDCC VR Sbjct: 270 NTRDDKIVLYFTSLRGIRKTYEDCCAVR 297 >ref|XP_002308899.1| hypothetical protein POPTRDRAFT_416706 [Populus trichocarpa] gi|222854875|gb|EEE92422.1| hypothetical protein POPTRDRAFT_416706 [Populus trichocarpa] Length = 373 Score = 51.6 bits (122), Expect(2) = 4e-12 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 300 VLVDERDVSMDSKYRKDLQSVFEGKRFSLPQVFV 199 V VDERD+SMDS YRK+LQS+ +GK LPQVFV Sbjct: 258 VAVDERDISMDSTYRKELQSLLKGKAMILPQVFV 291 Score = 44.3 bits (103), Expect(2) = 4e-12 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 Query: 412 NYKKDMIVLYFTNMRGIRKTCEDCCQVR 329 N K IVLYFT++RGIRKT EDCC VR Sbjct: 223 NDKDGKIVLYFTSLRGIRKTYEDCCAVR 250 >ref|XP_003554133.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] Length = 424 Score = 47.8 bits (112), Expect(3) = 3e-11 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -1 Query: 300 VLVDERDVSMDSKYRKDLQSVFEGKRFSLPQVFV 199 V VDERD+SMDS YRK+L+ GK +LPQVF+ Sbjct: 308 VAVDERDISMDSSYRKELKDALGGKAVTLPQVFI 341 Score = 42.0 bits (97), Expect(3) = 3e-11 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 403 KDMIVLYFTNMRGIRKTCEDCCQVR 329 +D IVLY T++RGIRKT EDCC VR Sbjct: 276 EDRIVLYCTSLRGIRKTYEDCCSVR 300 Score = 22.7 bits (47), Expect(3) = 3e-11 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -3 Query: 145 MCDNCNENGLIHCQGC 98 +CDNC + + C C Sbjct: 376 VCDNCGDARFVPCPNC 391 >ref|XP_002323258.1| hypothetical protein POPTRDRAFT_255411 [Populus trichocarpa] gi|222867888|gb|EEF05019.1| hypothetical protein POPTRDRAFT_255411 [Populus trichocarpa] Length = 147 Score = 50.4 bits (119), Expect(2) = 4e-11 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 300 VLVDERDVSMDSKYRKDLQSVFEGKRFSLPQVF 202 V +DERD+SMDS Y+K+LQS+ +GK SLPQVF Sbjct: 31 VAIDERDISMDSTYKKELQSLLKGKPMSLPQVF 63 Score = 42.4 bits (98), Expect(2) = 4e-11 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 394 IVLYFTNMRGIRKTCEDCCQVR 329 IVLYFT++RGIRKT EDCC VR Sbjct: 2 IVLYFTSLRGIRKTYEDCCAVR 23