BLASTX nr result
ID: Angelica23_contig00026523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00026523 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234426.1| kinesin related protein [Solanum lycopersicu... 64 1e-08 ref|XP_002866100.1| predicted protein [Arabidopsis lyrata subsp.... 56 3e-06 >ref|NP_001234426.1| kinesin related protein [Solanum lycopersicum] gi|27462172|gb|AAO15358.1|AF242356_1 kinesin related protein [Solanum lycopersicum] Length = 1191 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 8/71 (11%) Frame = -2 Query: 258 MSENRFMGTLSASSIRNLLPRSLSNKRKTSN---KSSFNSENIPPLTDPNIQSSN----- 103 MSENRF+G +SASS RNLLP+S+S K+K S+ K NSEN+ P+ DPN+Q S+ Sbjct: 1 MSENRFLGNISASSFRNLLPKSVSTKKKLSSSRFKHKMNSENVAPI-DPNVQISDPPLLP 59 Query: 102 LAPVIKKSPIK 70 + ++KK+ +K Sbjct: 60 TSSILKKTVLK 70 >ref|XP_002866100.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311935|gb|EFH42359.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 5/59 (8%) Frame = -2 Query: 264 SEMSENRFMGTLSASSIRNLLPRSLSNKRKT---SNKSSF--NSENIPPLTDPNIQSSN 103 +++ ENRF+G LS SSIRNLLPRS+ K+K+ S+ SF N EN PP DPNIQ+++ Sbjct: 8 AKIGENRFLGNLSTSSIRNLLPRSIYAKQKSIQNSDTKSFRSNDENAPP-CDPNIQTNH 65