BLASTX nr result
ID: Angelica23_contig00026261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00026261 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136879.1| PREDICTED: UDP-glycosyltransferase 85A2-like... 61 8e-08 ref|XP_004173933.1| PREDICTED: UDP-glycosyltransferase 85A3-like... 60 2e-07 ref|XP_004172439.1| PREDICTED: UDP-glycosyltransferase 85A3-like... 60 2e-07 ref|XP_004137056.1| PREDICTED: UDP-glycosyltransferase 85A5-like... 59 3e-07 ref|XP_003618658.1| Cytokinin-O-glucosyltransferase [Medicago tr... 59 3e-07 >ref|XP_004136879.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus] Length = 488 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -2 Query: 307 MDGEKGKEMRKNALELKKKARDALVPGGSSLENLDKLINEVLL 179 MDGEKGK+M++NA+ LK KA +A PGGS+ + LDKLINEVLL Sbjct: 440 MDGEKGKKMKENAMFLKSKAEEAYKPGGSAYKQLDKLINEVLL 482 >ref|XP_004173933.1| PREDICTED: UDP-glycosyltransferase 85A3-like, partial [Cucumis sativus] Length = 187 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 307 MDGEKGKEMRKNALELKKKARDALVPGGSSLENLDKLINEVLL 179 MDGEKGK+M++N + LK KA +A PGGS+ + LDKLINEVLL Sbjct: 139 MDGEKGKKMKENVMYLKSKAEEAYKPGGSAYKQLDKLINEVLL 181 >ref|XP_004172439.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus] Length = 312 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 307 MDGEKGKEMRKNALELKKKARDALVPGGSSLENLDKLINEVLL 179 MDGEKGK+M++N + LK KA +A PGGS+ + LDKLINEVLL Sbjct: 264 MDGEKGKKMKENVMYLKSKAEEAYKPGGSAYKQLDKLINEVLL 306 >ref|XP_004137056.1| PREDICTED: UDP-glycosyltransferase 85A5-like, partial [Cucumis sativus] Length = 722 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 307 MDGEKGKEMRKNALELKKKARDALVPGGSSLENLDKLINEVLL 179 MDGEKGK+M++N + LK KA +A PGG S + LDKLINEVLL Sbjct: 679 MDGEKGKKMKENVMNLKSKAEEAYKPGGLSWKQLDKLINEVLL 721 >ref|XP_003618658.1| Cytokinin-O-glucosyltransferase [Medicago truncatula] gi|355493673|gb|AES74876.1| Cytokinin-O-glucosyltransferase [Medicago truncatula] Length = 480 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 307 MDGEKGKEMRKNALELKKKARDALVPGGSSLENLDKLINEVLLR 176 M GEKGK+MRK A+ELKKKA + PGG S NLDKLI EVLL+ Sbjct: 437 MVGEKGKKMRKKAIELKKKAEENTRPGGCSYMNLDKLIKEVLLK 480