BLASTX nr result
ID: Angelica23_contig00026143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00026143 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266448.1| PREDICTED: OTU domain-containing protein At3... 112 3e-23 ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3... 106 2e-21 ref|XP_002330989.1| predicted protein [Populus trichocarpa] gi|2... 106 2e-21 ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3... 105 4e-21 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 104 7e-21 >ref|XP_002266448.1| PREDICTED: OTU domain-containing protein At3g57810 [Vitis vinifera] gi|297738381|emb|CBI27582.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 112 bits (280), Expect = 3e-23 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = +3 Query: 6 VVNEFIKRRADSEWYLDGDFDAYITHMRQPHFWGGEPELLMASHVLKMPISVYMFDKKSN 185 VV+EFIKRRAD+EW+L+GDFD Y+ MRQPH WGGEPELLM+SHVL+MPI+VYM +K SN Sbjct: 50 VVDEFIKRRADTEWFLEGDFDDYVLRMRQPHIWGGEPELLMSSHVLQMPITVYMSEKNSN 109 Query: 186 TLKTIAE 206 LK IAE Sbjct: 110 DLKVIAE 116 >ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449494889|ref|XP_004159675.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 145 Score = 106 bits (265), Expect = 2e-21 Identities = 48/68 (70%), Positives = 56/68 (82%) Frame = +3 Query: 3 NVVNEFIKRRADSEWYLDGDFDAYITHMRQPHFWGGEPELLMASHVLKMPISVYMFDKKS 182 NV NE +KRR D+E +++GDF Y+ HMRQPH WGGEPELLM+SHVL+MPISVYM DKKS Sbjct: 49 NVANELMKRRLDTERFIEGDFGQYVRHMRQPHVWGGEPELLMSSHVLQMPISVYMCDKKS 108 Query: 183 NTLKTIAE 206 LK IAE Sbjct: 109 GNLKVIAE 116 >ref|XP_002330989.1| predicted protein [Populus trichocarpa] gi|222872919|gb|EEF10050.1| predicted protein [Populus trichocarpa] Length = 223 Score = 106 bits (264), Expect = 2e-21 Identities = 46/68 (67%), Positives = 58/68 (85%) Frame = +3 Query: 3 NVVNEFIKRRADSEWYLDGDFDAYITHMRQPHFWGGEPELLMASHVLKMPISVYMFDKKS 182 NV +EFIKRR D+EW+++G+FD Y++ MR+PH WGGEPELLMASHVLKMPI+VYM DK + Sbjct: 124 NVADEFIKRREDTEWFIEGNFDTYVSQMRKPHVWGGEPELLMASHVLKMPITVYMHDKNA 183 Query: 183 NTLKTIAE 206 L +IAE Sbjct: 184 RGLISIAE 191 >ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3g57810-like [Glycine max] Length = 156 Score = 105 bits (262), Expect = 4e-21 Identities = 47/67 (70%), Positives = 56/67 (83%) Frame = +3 Query: 6 VVNEFIKRRADSEWYLDGDFDAYITHMRQPHFWGGEPELLMASHVLKMPISVYMFDKKSN 185 VV+EFIKRR D+EW+L+GDFD Y MR+PH WGGEPELLM+SHVL+MPI+V M DK S+ Sbjct: 60 VVDEFIKRRVDTEWFLEGDFDTYTVQMRKPHIWGGEPELLMSSHVLQMPITVLMQDKSSS 119 Query: 186 TLKTIAE 206 LK IAE Sbjct: 120 NLKVIAE 126 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 104 bits (260), Expect = 7e-21 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = +3 Query: 6 VVNEFIKRRADSEWYLDGDFDAYITHMRQPHFWGGEPELLMASHVLKMPISVYMFDKKSN 185 V +EFIKRR D+EW+L+ DFD Y+ MRQPH WGGEPELLM+SHVLK+PI+VYM D+ S Sbjct: 66 VADEFIKRRRDTEWFLEDDFDTYVGQMRQPHVWGGEPELLMSSHVLKIPITVYMRDRNSG 125 Query: 186 TLKTIAE 206 +LK IAE Sbjct: 126 SLKVIAE 132