BLASTX nr result
ID: Angelica23_contig00025904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025904 (472 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310764.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 ref|XP_004167438.1| PREDICTED: LOW QUALITY PROTEIN: protease 2-l... 78 7e-13 ref|XP_004139255.1| PREDICTED: protease 2-like [Cucumis sativus] 78 7e-13 ref|XP_002522361.1| oligopeptidase B, putative [Ricinus communis... 75 4e-12 ref|XP_003548911.1| PREDICTED: protease 2-like [Glycine max] 75 6e-12 >ref|XP_002310764.1| predicted protein [Populus trichocarpa] gi|222853667|gb|EEE91214.1| predicted protein [Populus trichocarpa] Length = 730 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 468 ARVREDTIYDPKRPKLLNLSTDIVEENRYLQCKESAFETAFLLKVMDS 325 ARVRE TIYDPKRP LLNL+TDIVEENRYLQCKESA ETAFL+K+M+S Sbjct: 683 ARVREHTIYDPKRPILLNLTTDIVEENRYLQCKESALETAFLIKMMES 730 >ref|XP_004167438.1| PREDICTED: LOW QUALITY PROTEIN: protease 2-like [Cucumis sativus] Length = 790 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 471 VARVREDTIYDPKRPKLLNLSTDIVEENRYLQCKESAFETAFLLKVMDS 325 +ARVR+ +IYDPKRP +LNL+ DIVEENRYL CKESA ETAFL+K M+S Sbjct: 742 IARVRDYSIYDPKRPVILNLTIDIVEENRYLHCKESALETAFLMKAMES 790 >ref|XP_004139255.1| PREDICTED: protease 2-like [Cucumis sativus] Length = 790 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 471 VARVREDTIYDPKRPKLLNLSTDIVEENRYLQCKESAFETAFLLKVMDS 325 +ARVR+ +IYDPKRP +LNL+ DIVEENRYL CKESA ETAFL+K M+S Sbjct: 742 IARVRDYSIYDPKRPVILNLTIDIVEENRYLHCKESALETAFLMKAMES 790 >ref|XP_002522361.1| oligopeptidase B, putative [Ricinus communis] gi|223538439|gb|EEF40045.1| oligopeptidase B, putative [Ricinus communis] Length = 788 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 471 VARVREDTIYDPKRPKLLNLSTDIVEENRYLQCKESAFETAFLLKVMDS 325 VARVRE I DP RP LLNL+T+IVEENRYLQCKESA ETAFL+++M++ Sbjct: 740 VARVRERAINDPSRPILLNLTTEIVEENRYLQCKESAMETAFLIRMMET 788 >ref|XP_003548911.1| PREDICTED: protease 2-like [Glycine max] Length = 775 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 471 VARVREDTIYDPKRPKLLNLSTDIVEENRYLQCKESAFETAFLLKVMDS 325 VARVR+ +IYDPKRP LLNL+TD+VEENRYLQ KESA E FL+K+M+S Sbjct: 727 VARVRDLSIYDPKRPILLNLTTDLVEENRYLQSKESALEATFLMKMMES 775