BLASTX nr result
ID: Angelica23_contig00025868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025868 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283728.2| PREDICTED: LRR receptor-like serine/threonin... 56 3e-06 >ref|XP_002283728.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Length = 827 Score = 55.8 bits (133), Expect = 3e-06 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = +3 Query: 36 QEPWFLWTGALIGFSLGFVLSVLIAFVSGYFVLPPPKPKYH 158 +EPWFLW G IG+ +G +L++ I F++GYF LPPP + H Sbjct: 777 KEPWFLWEGVWIGYPVGLLLAIGIIFLTGYFTLPPPSNRRH 817