BLASTX nr result
ID: Angelica23_contig00025816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025816 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 70 2e-10 emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] 70 2e-10 ref|XP_002311408.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus... 67 1e-09 ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 65 4e-09 >ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera] gi|297738231|emb|CBI27432.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 3 EKWEATQRAEEIRCRANDFSSPQQFSNLNDNSILLVQEMELSGPR 137 EKWEATQRAE RC+AN+FSS +++S+L D+S LLVQ MELSGPR Sbjct: 581 EKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 625 >emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] Length = 609 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 3 EKWEATQRAEEIRCRANDFSSPQQFSNLNDNSILLVQEMELSGPR 137 EKWEATQRAE RC+AN+FSS +++S+L D+S LLVQ MELSGPR Sbjct: 565 EKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 609 >ref|XP_002311408.1| predicted protein [Populus trichocarpa] gi|222851228|gb|EEE88775.1| predicted protein [Populus trichocarpa] Length = 622 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 3 EKWEATQRAEEIRCRANDFSSPQQFSNLNDNSILLVQEMELSGPR 137 EKWEA+QRAEE R RAN+FSS +++S+L D+S LLVQ MELSGPR Sbjct: 578 EKWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 622 >gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa] Length = 622 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 3 EKWEATQRAEEIRCRANDFSSPQQFSNLNDNSILLVQEMELSGPR 137 EKWEA+QRAEE R RAN+FSS +++S+L D+S LLVQ MELSGPR Sbjct: 578 EKWEASQRAEESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 622 >ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223546140|gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 576 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +3 Query: 3 EKWEATQRAEEIRCRANDFSSPQQFSNLNDNSILLVQEMELSGPR 137 EKWEA+QRAE R RAN+FSS +++S+L D+S LLVQ MELSGPR Sbjct: 532 EKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 576