BLASTX nr result
ID: Angelica23_contig00025716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025716 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE68357.1| hypothetical protein OsJ_26660 [Oryza sativa Japo... 64 1e-08 gb|EEC83878.1| hypothetical protein OsI_29877 [Oryza sativa Indi... 64 1e-08 ref|XP_002448691.1| hypothetical protein SORBIDRAFT_06g031610 [S... 64 1e-08 ref|XP_004143390.1| PREDICTED: uncharacterized protein LOC101211... 62 6e-08 tpg|DAA35555.1| TPA: putative DUF231 domain containing family pr... 62 6e-08 >gb|EEE68357.1| hypothetical protein OsJ_26660 [Oryza sativa Japonica Group] Length = 404 Score = 64.3 bits (155), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 219 CSHWCLPGVPDTWNEVLYAHLLSRGFQVR 133 CSHWCLPGVPDTWNEVLYAHL+S G+ +R Sbjct: 374 CSHWCLPGVPDTWNEVLYAHLMSMGYDIR 402 >gb|EEC83878.1| hypothetical protein OsI_29877 [Oryza sativa Indica Group] Length = 375 Score = 64.3 bits (155), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 219 CSHWCLPGVPDTWNEVLYAHLLSRGFQVR 133 CSHWCLPGVPDTWNEVLYAHL+S G+ +R Sbjct: 345 CSHWCLPGVPDTWNEVLYAHLMSMGYDIR 373 >ref|XP_002448691.1| hypothetical protein SORBIDRAFT_06g031610 [Sorghum bicolor] gi|241939874|gb|EES13019.1| hypothetical protein SORBIDRAFT_06g031610 [Sorghum bicolor] Length = 333 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 219 CSHWCLPGVPDTWNEVLYAHLLSRGFQVRRK 127 CSHWCLPGVPD WN+VLYAHLLS G+ RRK Sbjct: 301 CSHWCLPGVPDVWNQVLYAHLLSTGYGTRRK 331 >ref|XP_004143390.1| PREDICTED: uncharacterized protein LOC101211013 [Cucumis sativus] gi|449519312|ref|XP_004166679.1| PREDICTED: uncharacterized protein LOC101225789 [Cucumis sativus] Length = 432 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 219 CSHWCLPGVPDTWNEVLYAHLLSRGFQ 139 CSHWCLPGVPDTWNE++YAHLLS GF+ Sbjct: 405 CSHWCLPGVPDTWNELVYAHLLSNGFR 431 >tpg|DAA35555.1| TPA: putative DUF231 domain containing family protein [Zea mays] Length = 416 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 219 CSHWCLPGVPDTWNEVLYAHLLSRGFQVRR 130 CSHWCLPGVPD WN++LYAHLLS G+ RR Sbjct: 384 CSHWCLPGVPDVWNQILYAHLLSAGYGTRR 413