BLASTX nr result
ID: Angelica23_contig00025588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025588 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512034.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 ref|XP_002314922.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 emb|CBI27324.3| unnamed protein product [Vitis vinifera] 70 1e-10 ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778... 70 2e-10 >ref|XP_002512034.1| conserved hypothetical protein [Ricinus communis] gi|223549214|gb|EEF50703.1| conserved hypothetical protein [Ricinus communis] Length = 632 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/44 (79%), Positives = 43/44 (97%) Frame = -1 Query: 289 HAAFKRALLTFHPDRSSQSDIRQQVEAEEKFKLVTRMKEKYLST 158 HAA+KRALL FHPDR+S++DIRQQVEAEEKFKL++RMK+K+LST Sbjct: 586 HAAYKRALLKFHPDRASRTDIRQQVEAEEKFKLISRMKQKFLST 629 >ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|222852165|gb|EEE89712.1| predicted protein [Populus trichocarpa] Length = 116 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/44 (79%), Positives = 43/44 (97%) Frame = -1 Query: 289 HAAFKRALLTFHPDRSSQSDIRQQVEAEEKFKLVTRMKEKYLST 158 HAA+KRALL FHPDR+S++DIR+QVEAEEKFKL++RMKEK+LST Sbjct: 70 HAAYKRALLKFHPDRASKTDIRRQVEAEEKFKLISRMKEKFLST 113 >ref|XP_002314922.1| predicted protein [Populus trichocarpa] gi|222863962|gb|EEF01093.1| predicted protein [Populus trichocarpa] Length = 724 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -1 Query: 289 HAAFKRALLTFHPDRSSQSDIRQQVEAEEKFKLVTRMKEKYLST 158 HAA+KRALL HPDR+S++DIRQQVEAEEKFKL++RMKEK+LST Sbjct: 678 HAAYKRALLKLHPDRASKTDIRQQVEAEEKFKLISRMKEKFLST 721 >emb|CBI27324.3| unnamed protein product [Vitis vinifera] Length = 620 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -1 Query: 289 HAAFKRALLTFHPDRSSQSDIRQQVEAEEKFKLVTRMKEKYL 164 HAA+KRALL FHPDR+S++DI QVEAEEKFKL++RMKEK+L Sbjct: 576 HAAYKRALLKFHPDRASRTDIYHQVEAEEKFKLISRMKEKFL 617 >ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778452 [Glycine max] Length = 555 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/41 (73%), Positives = 39/41 (95%) Frame = -1 Query: 289 HAAFKRALLTFHPDRSSQSDIRQQVEAEEKFKLVTRMKEKY 167 HAA+KRALL FHPDR+S++D+R QVEAEEKFKL++R+KEK+ Sbjct: 509 HAAYKRALLKFHPDRASKTDVRAQVEAEEKFKLISRLKEKF 549