BLASTX nr result
ID: Angelica23_contig00025574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025574 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142670.1| PREDICTED: uncharacterized protein LOC101209... 81 1e-13 gb|AEX11624.1| hypothetical protein 0_16046_01 [Pinus radiata] 80 2e-13 gb|AEX11606.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|... 79 5e-13 ref|NP_001044596.2| Os01g0812900 [Oryza sativa Japonica Group] g... 78 8e-13 gb|EEE55565.1| hypothetical protein OsJ_03840 [Oryza sativa Japo... 78 8e-13 >ref|XP_004142670.1| PREDICTED: uncharacterized protein LOC101209534 isoform 1 [Cucumis sativus] gi|449449837|ref|XP_004142671.1| PREDICTED: uncharacterized protein LOC101209534 isoform 2 [Cucumis sativus] gi|449510965|ref|XP_004163824.1| PREDICTED: uncharacterized protein LOC101229310 isoform 1 [Cucumis sativus] gi|449510969|ref|XP_004163825.1| PREDICTED: uncharacterized protein LOC101229310 isoform 2 [Cucumis sativus] Length = 370 Score = 80.9 bits (198), Expect = 1e-13 Identities = 45/76 (59%), Positives = 56/76 (73%), Gaps = 2/76 (2%) Frame = -2 Query: 363 VEYVLAKGLPSFVFKTSVVVLRAVNNVMGGMSFVVLARLTGSQSSDANERKLV--TSEEE 190 VEYVLAKGLP FK+SVVVLR +NNV+GGMSFVVLAR+TGSQS + + V S +E Sbjct: 290 VEYVLAKGLPPLAFKSSVVVLRCLNNVLGGMSFVVLARMTGSQSVEGPKTAGVELDSGDE 349 Query: 189 AEILAAGDEKDKLLHN 142 E L GD++++L N Sbjct: 350 KEKLLEGDKEEELRSN 365 >gb|AEX11624.1| hypothetical protein 0_16046_01 [Pinus radiata] Length = 133 Score = 79.7 bits (195), Expect = 2e-13 Identities = 43/70 (61%), Positives = 51/70 (72%) Frame = -2 Query: 363 VEYVLAKGLPSFVFKTSVVVLRAVNNVMGGMSFVVLARLTGSQSSDANERKLVTSEEEAE 184 +EY+LAKGLP FVFKTSVVVLR +NNV+GGMSFV+LARLTGSQ D L S+EE Sbjct: 62 IEYLLAKGLPPFVFKTSVVVLRCLNNVLGGMSFVILARLTGSQKVDP---PLTLSQEEKT 118 Query: 183 ILAAGDEKDK 154 L ++ K Sbjct: 119 KLLDEEKNSK 128 >gb|AEX11606.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062535|gb|AEX11607.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062537|gb|AEX11608.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062539|gb|AEX11609.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062541|gb|AEX11610.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062543|gb|AEX11611.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062545|gb|AEX11612.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062547|gb|AEX11613.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062549|gb|AEX11614.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062551|gb|AEX11615.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062553|gb|AEX11616.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062555|gb|AEX11617.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062557|gb|AEX11618.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062559|gb|AEX11619.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062561|gb|AEX11620.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062563|gb|AEX11621.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062565|gb|AEX11622.1| hypothetical protein 0_16046_01 [Pinus taeda] gi|367062567|gb|AEX11623.1| hypothetical protein 0_16046_01 [Pinus taeda] Length = 133 Score = 78.6 bits (192), Expect = 5e-13 Identities = 42/70 (60%), Positives = 51/70 (72%) Frame = -2 Query: 363 VEYVLAKGLPSFVFKTSVVVLRAVNNVMGGMSFVVLARLTGSQSSDANERKLVTSEEEAE 184 +EY+LAKGLP FVFKTSVVVLR +NNV+GGMSFV+LARLTGSQ D L S+E+ Sbjct: 62 IEYLLAKGLPPFVFKTSVVVLRCLNNVLGGMSFVILARLTGSQKVDP---PLTLSQEQKT 118 Query: 183 ILAAGDEKDK 154 L ++ K Sbjct: 119 KLLDQEKNSK 128 >ref|NP_001044596.2| Os01g0812900 [Oryza sativa Japonica Group] gi|55297499|dbj|BAD68215.1| unknown protein [Oryza sativa Japonica Group] gi|56785038|dbj|BAD82677.1| unknown protein [Oryza sativa Japonica Group] gi|255673805|dbj|BAF06510.2| Os01g0812900 [Oryza sativa Japonica Group] Length = 348 Score = 77.8 bits (190), Expect = 8e-13 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -2 Query: 363 VEYVLAKGLPSFVFKTSVVVLRAVNNVMGGMSFVVLARLTGSQSSDANERKLVTSEEEAE 184 VEY+LA P VFK SVV LR +NNV+GGMSFV+LARLTGSQ SDA EE+ Sbjct: 267 VEYLLANAAPPSVFKVSVVALRCINNVLGGMSFVLLARLTGSQKSDAPAASATAEEEKER 326 Query: 183 ILAAGDE 163 ++A G++ Sbjct: 327 LIAVGND 333 >gb|EEE55565.1| hypothetical protein OsJ_03840 [Oryza sativa Japonica Group] Length = 320 Score = 77.8 bits (190), Expect = 8e-13 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -2 Query: 363 VEYVLAKGLPSFVFKTSVVVLRAVNNVMGGMSFVVLARLTGSQSSDANERKLVTSEEEAE 184 VEY+LA P VFK SVV LR +NNV+GGMSFV+LARLTGSQ SDA EE+ Sbjct: 239 VEYLLANAAPPSVFKVSVVALRCINNVLGGMSFVLLARLTGSQKSDAPAASATAEEEKER 298 Query: 183 ILAAGDE 163 ++A G++ Sbjct: 299 LIAVGND 305