BLASTX nr result
ID: Angelica23_contig00025500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025500 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278416.2| PREDICTED: transcription elongation factor S... 161 5e-38 emb|CBI32841.3| unnamed protein product [Vitis vinifera] 161 5e-38 gb|AAC27151.1| Similar to gb|U46691 putative chromatin structure... 161 6e-38 ref|NP_176723.3| transcription elongation factor SPT6 [Arabidops... 161 6e-38 ref|NP_001185317.1| transcription elongation factor SPT6 [Arabid... 161 6e-38 >ref|XP_002278416.2| PREDICTED: transcription elongation factor SPT6-like [Vitis vinifera] Length = 1660 Score = 161 bits (408), Expect = 5e-38 Identities = 75/88 (85%), Positives = 81/88 (92%) Frame = +1 Query: 1 DTFEDLDEVIDRYVDPLVVQLKVMLNYRKFKKGTKAEVDELLRIEKAENPMRIVYCFGIS 180 DTFEDLDEV+DRYVDPLV LK ML+YRKF++GTKAEVDE LRIEK+E PMRIVYCFGIS Sbjct: 1321 DTFEDLDEVMDRYVDPLVTHLKAMLSYRKFRRGTKAEVDEQLRIEKSEYPMRIVYCFGIS 1380 Query: 181 HEHPGTCILTYIRSSNPHHEYVGVYPTG 264 HEHPGT ILTYIRSSNPHHEYVG+YP G Sbjct: 1381 HEHPGTFILTYIRSSNPHHEYVGLYPKG 1408 >emb|CBI32841.3| unnamed protein product [Vitis vinifera] Length = 1646 Score = 161 bits (408), Expect = 5e-38 Identities = 75/88 (85%), Positives = 81/88 (92%) Frame = +1 Query: 1 DTFEDLDEVIDRYVDPLVVQLKVMLNYRKFKKGTKAEVDELLRIEKAENPMRIVYCFGIS 180 DTFEDLDEV+DRYVDPLV LK ML+YRKF++GTKAEVDE LRIEK+E PMRIVYCFGIS Sbjct: 1307 DTFEDLDEVMDRYVDPLVTHLKAMLSYRKFRRGTKAEVDEQLRIEKSEYPMRIVYCFGIS 1366 Query: 181 HEHPGTCILTYIRSSNPHHEYVGVYPTG 264 HEHPGT ILTYIRSSNPHHEYVG+YP G Sbjct: 1367 HEHPGTFILTYIRSSNPHHEYVGLYPKG 1394 >gb|AAC27151.1| Similar to gb|U46691 putative chromatin structure regulator (SUPT6H) from Homo sapiens. ESTs gb|T42908, gb|AA586170 and gb|AA395125 come from this gene [Arabidopsis thaliana] Length = 1684 Score = 161 bits (407), Expect = 6e-38 Identities = 73/88 (82%), Positives = 81/88 (92%) Frame = +1 Query: 1 DTFEDLDEVIDRYVDPLVVQLKVMLNYRKFKKGTKAEVDELLRIEKAENPMRIVYCFGIS 180 DTFEDLDEV+DRYVDPLV LK MLNYRKF+KGTK+EVD+LLRIEK ENP RIVYCFGIS Sbjct: 1338 DTFEDLDEVMDRYVDPLVSHLKTMLNYRKFRKGTKSEVDDLLRIEKGENPSRIVYCFGIS 1397 Query: 181 HEHPGTCILTYIRSSNPHHEYVGVYPTG 264 HEHPGT IL+YIRS+NPHHEY+G+YP G Sbjct: 1398 HEHPGTFILSYIRSTNPHHEYIGLYPKG 1425 >ref|NP_176723.3| transcription elongation factor SPT6 [Arabidopsis thaliana] gi|332196252|gb|AEE34373.1| transcription elongation factor SPT6 [Arabidopsis thaliana] Length = 1647 Score = 161 bits (407), Expect = 6e-38 Identities = 73/88 (82%), Positives = 81/88 (92%) Frame = +1 Query: 1 DTFEDLDEVIDRYVDPLVVQLKVMLNYRKFKKGTKAEVDELLRIEKAENPMRIVYCFGIS 180 DTFEDLDEV+DRYVDPLV LK MLNYRKF+KGTK+EVD+LLRIEK ENP RIVYCFGIS Sbjct: 1301 DTFEDLDEVMDRYVDPLVSHLKTMLNYRKFRKGTKSEVDDLLRIEKGENPSRIVYCFGIS 1360 Query: 181 HEHPGTCILTYIRSSNPHHEYVGVYPTG 264 HEHPGT IL+YIRS+NPHHEY+G+YP G Sbjct: 1361 HEHPGTFILSYIRSTNPHHEYIGLYPKG 1388 >ref|NP_001185317.1| transcription elongation factor SPT6 [Arabidopsis thaliana] gi|332196254|gb|AEE34375.1| transcription elongation factor SPT6 [Arabidopsis thaliana] Length = 1454 Score = 161 bits (407), Expect = 6e-38 Identities = 73/88 (82%), Positives = 81/88 (92%) Frame = +1 Query: 1 DTFEDLDEVIDRYVDPLVVQLKVMLNYRKFKKGTKAEVDELLRIEKAENPMRIVYCFGIS 180 DTFEDLDEV+DRYVDPLV LK MLNYRKF+KGTK+EVD+LLRIEK ENP RIVYCFGIS Sbjct: 1272 DTFEDLDEVMDRYVDPLVSHLKTMLNYRKFRKGTKSEVDDLLRIEKGENPSRIVYCFGIS 1331 Query: 181 HEHPGTCILTYIRSSNPHHEYVGVYPTG 264 HEHPGT IL+YIRS+NPHHEY+G+YP G Sbjct: 1332 HEHPGTFILSYIRSTNPHHEYIGLYPKG 1359