BLASTX nr result
ID: Angelica23_contig00025409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025409 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514651.1| replication factor A 1, rfa1, putative [Rici... 41 5e-07 >ref|XP_002514651.1| replication factor A 1, rfa1, putative [Ricinus communis] gi|223546255|gb|EEF47757.1| replication factor A 1, rfa1, putative [Ricinus communis] Length = 622 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 28/58 (48%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 240 DLASTVGQELLDIAD*SPVVAFK--PXXXXXXXXXXXXXXSVIVVDLETTELK*LKSW 73 DLA+ VGQELLD+AD SPVVA K S+I V+ +T E K LKSW Sbjct: 358 DLATDVGQELLDMADKSPVVAIKALKVGDFQGVSLSTLGRSIIQVNPDTPESKKLKSW 415 Score = 37.4 bits (85), Expect(2) = 5e-07 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 74 GKEISMASVGTGLSPTSRSGG*SM 3 GKE S+ASVG GLSP+++SGG SM Sbjct: 420 GKETSLASVGAGLSPSTKSGGGSM 443