BLASTX nr result
ID: Angelica23_contig00025334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025334 (587 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 70 3e-10 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +2 Query: 86 QMAANSLSMRFSKTRSWQKCPKRVKQQKARLYIIWRCTVLLMNWQE 223 QMAA++LSMR K RSWQ+C K++++Q+ RLYIIWRCTV+L+ W + Sbjct: 19 QMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +2 Query: 110 MRFSKTRSWQKCPKRVKQQKARLYIIWRCTVLLMNWQE 223 +RF K RSWQ+C + VK+Q+ RLYIIWRCTV+L++W + Sbjct: 9 IRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46