BLASTX nr result
ID: Angelica23_contig00025269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025269 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37793.1| unknown [Medicago truncatula] 71 8e-11 ref|XP_003611004.1| Ethylene-responsive transcription factor ERF... 71 8e-11 ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription... 66 3e-09 ref|XP_002509951.1| DNA binding protein, putative [Ricinus commu... 66 3e-09 ref|XP_002304554.1| AP2/ERF domain-containing transcription fact... 64 1e-08 >gb|AFK37793.1| unknown [Medicago truncatula] Length = 320 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -1 Query: 395 SSSVSEDGLWMDVNSPYSVLGAYATVTQELEFEGCSLARMPSFDPELIWQVLA 237 S +VSEDG+W NSP SV VT+E EFE CSLARMPSFDPELIW+VLA Sbjct: 270 SPTVSEDGIWKGENSPNSVS---TMVTEETEFEDCSLARMPSFDPELIWEVLA 319 >ref|XP_003611004.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] gi|355512339|gb|AES93962.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] Length = 320 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -1 Query: 395 SSSVSEDGLWMDVNSPYSVLGAYATVTQELEFEGCSLARMPSFDPELIWQVLA 237 S +VSEDG+W NSP SV VT+E EFE CSLARMPSFDPELIW+VLA Sbjct: 270 SPTVSEDGIWKGENSPNSVS---TMVTEETEFEDCSLARMPSFDPELIWEVLA 319 >ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] Length = 314 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/54 (64%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = -1 Query: 395 SSSVSEDGLWMDVNS--PYSVLGAYATVTQELEFEGCSLARMPSFDPELIWQVL 240 S +VSEDG W NS P SVL T EL FEGCSLAR+PSFDPELIW+VL Sbjct: 259 SPAVSEDGFWKGENSHSPASVLTECQTEETELLFEGCSLARLPSFDPELIWEVL 312 >ref|XP_002509951.1| DNA binding protein, putative [Ricinus communis] gi|223549850|gb|EEF51338.1| DNA binding protein, putative [Ricinus communis] Length = 315 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -1 Query: 398 VSSSVSEDGLWMDVNSPYSV-LGAYATVTQELEFEGCSLARMPSFDPELIWQVLA 237 VS ++SEDG W NSP SV V Q +EFE CSLARMPSFDPELIW VLA Sbjct: 260 VSPTISEDGFWKCENSPPSVSTDCSILVPQVMEFEDCSLARMPSFDPELIWAVLA 314 >ref|XP_002304554.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|222841986|gb|EEE79533.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 311 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -1 Query: 398 VSSSVSEDGLWM--DVNSPYSVLGAYATVTQELEFEGCSLARMPSFDPELIWQVLAN 234 VS +VSEDG W +SP V Q +EFE CSLARMPS+DPELIW+VLAN Sbjct: 255 VSPAVSEDGFWKCESSSSPSVSTDCPVMVPQAMEFEDCSLARMPSYDPELIWEVLAN 311