BLASTX nr result
ID: Angelica23_contig00025243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00025243 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 4e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 295 MGQRIKRFYFVSRDTPQVGFESRVMGDYPARFGE 396 MGQRIKRF FVSRD+PQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 67.4 bits (163), Expect = 1e-09 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 7/68 (10%) Frame = -2 Query: 283 ILLPADRAATLLVDKPSFKLLSFGSDKSSPFGRFAQ-------VVFPYLP*RSDSGLRKE 125 +LLPA AA D+ SFK LSFGSDKSSPFGRFAQ V FP + +S SGLRKE Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQVRWSSRSVGFPNV--KSCSGLRKE 55 Query: 124 HRPSALNE 101 HRPS LNE Sbjct: 56 HRPSTLNE 63