BLASTX nr result
ID: Angelica23_contig00024948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024948 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514085.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002514085.1| conserved hypothetical protein [Ricinus communis] gi|223546541|gb|EEF48039.1| conserved hypothetical protein [Ricinus communis] Length = 1120 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/81 (40%), Positives = 51/81 (62%), Gaps = 7/81 (8%) Frame = +1 Query: 241 MSRIVSRKRMGEDAGKGKLLNDIETLSKALNIDRTQPKGSL-------KSSGKIPVXXXX 399 MS++ RK++GED+G KLL +IET+SKAL +D++ + S+ K +GK + Sbjct: 7 MSKVEVRKKIGEDSGNAKLLREIETISKALYLDKSNSRPSISAPNNRSKPTGKSQL-LDP 65 Query: 400 XXXXXXXNEEASSKDKKSMWS 462 NEE+S+KDKKS+W+ Sbjct: 66 KSKLKYGNEESSNKDKKSIWN 86