BLASTX nr result
ID: Angelica23_contig00024875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024875 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMG48182.1| hypothetical protein G210_1294 [Candida maltosa X... 56 3e-06 >gb|EMG48182.1| hypothetical protein G210_1294 [Candida maltosa Xu316] Length = 2274 Score = 56.2 bits (134), Expect = 3e-06 Identities = 36/117 (30%), Positives = 66/117 (56%), Gaps = 17/117 (14%) Frame = -1 Query: 347 EELVLLKSEMEHLQAALKEENAQLK---TKKEEAEDRNKLQAKEIERLENEYKVETKKLQ 177 EEL +K E+E +AA+K+ +LK ++K E E K+ E++ L+N+YK ET L Sbjct: 1587 EELKNIKDELEKSKAAIKDSQVKLKDLESEKAELETTIKMVKTELKELQNKYKKETTSLN 1646 Query: 176 DRFE-------SQKEMMKEILNKVNGEQ-------RNMVEEITEKMKLLEKSICDLK 48 ++ + S K +K+ +++V E+ +++E ++K+K+LE I +LK Sbjct: 1647 EKVDEKEKQIVSLKNELKDRISEVEKERAMLSESSETVIQEYSDKIKVLEGKISELK 1703