BLASTX nr result
ID: Angelica23_contig00024864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024864 (563 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAI84657.1| hypothetical protein [Nicotiana tabacum] 40 5e-07 >emb|CAI84657.1| hypothetical protein [Nicotiana tabacum] Length = 621 Score = 40.0 bits (92), Expect(2) = 5e-07 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +2 Query: 308 DDECTEMEIDETVNG--SLKDEEGEASDGYVLFSRENPMVS 424 + +C EME++ G L +E GE S G V+FSRE+P+VS Sbjct: 16 ESQCFEMEVESCETGIPGLSNENGEGSHGNVVFSRESPLVS 56 Score = 38.9 bits (89), Expect(2) = 5e-07 Identities = 20/43 (46%), Positives = 28/43 (65%) Frame = +3 Query: 435 CTCGAAKKLKSGPTASESEPSDSDIGASEKKLSRQGRIELGRM 563 C CG KLK+ ++S+ E ++ EKKL+RQ RIELGR+ Sbjct: 71 CNCGV-NKLKARLSSSDCEVGKNEKSGHEKKLNRQERIELGRL 112