BLASTX nr result
ID: Angelica23_contig00024463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024463 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW67545.1| ADP-ribosylation factor [Daucus carota] 62 6e-08 ref|NP_001237005.1| uncharacterized protein LOC100305554 [Glycin... 60 3e-07 ref|XP_002520016.1| ADP-ribosylation factor, arf, putative [Rici... 60 3e-07 ref|XP_002274926.1| PREDICTED: ADP-ribosylation factor [Vitis vi... 59 5e-07 ref|XP_002319891.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >gb|AAW67545.1| ADP-ribosylation factor [Daucus carota] Length = 192 Score = 62.0 bits (149), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 GDGLYEGLDWLASTLKELKATGYSSIGTSS 92 GDGLYEGLDWLASTLKELKA GYSSIGTSS Sbjct: 163 GDGLYEGLDWLASTLKELKAAGYSSIGTSS 192 >ref|NP_001237005.1| uncharacterized protein LOC100305554 [Glycine max] gi|255625897|gb|ACU13293.1| unknown [Glycine max] Length = 176 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 3 GDGLYEGLDWLASTLKELKATGYSSIGTSS 92 GDGLYEGLDWLASTLKE KA GYSSIGTSS Sbjct: 146 GDGLYEGLDWLASTLKERKAAGYSSIGTSS 175 >ref|XP_002520016.1| ADP-ribosylation factor, arf, putative [Ricinus communis] gi|223540780|gb|EEF42340.1| ADP-ribosylation factor, arf, putative [Ricinus communis] Length = 193 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 GDGLYEGLDWLASTLKELKATGYSSIGTSS 92 GDGLYEGLDWLASTLKE++A GYSS+GTSS Sbjct: 163 GDGLYEGLDWLASTLKEMRAAGYSSVGTSS 192 >ref|XP_002274926.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera] gi|147778405|emb|CAN63035.1| hypothetical protein VITISV_023129 [Vitis vinifera] gi|297737336|emb|CBI26537.3| unnamed protein product [Vitis vinifera] Length = 193 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 GDGLYEGLDWLASTLKELKATGYSSIGTSS 92 GDGLYEGLDWLA TLKEL+A GYSS+GTSS Sbjct: 163 GDGLYEGLDWLAGTLKELRAAGYSSVGTSS 192 >ref|XP_002319891.1| predicted protein [Populus trichocarpa] gi|222858267|gb|EEE95814.1| predicted protein [Populus trichocarpa] Length = 193 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 GDGLYEGLDWLASTLKELKATGYSSIGTSS 92 GDGLYEGLDWL+ TLKE++A GYSS+GTSS Sbjct: 163 GDGLYEGLDWLSGTLKEMRAAGYSSVGTSS 192