BLASTX nr result
ID: Angelica23_contig00024420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024420 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ74700.1| quinone oxidoreductase-like protein [Phaseolus vu... 89 3e-16 ref|XP_003553854.1| PREDICTED: quinone oxidoreductase-like prote... 87 1e-15 ref|NP_001151204.1| quinone oxidoreductase-like protein At1g2374... 86 3e-15 ref|XP_002525379.1| alcohol dehydrogenase, putative [Ricinus com... 86 4e-15 gb|ABK92721.1| unknown [Populus trichocarpa] 85 5e-15 >gb|ACZ74700.1| quinone oxidoreductase-like protein [Phaseolus vulgaris] Length = 321 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = +3 Query: 84 GDEVYGNVNENPLKNCKRSGTLAEFTAVEEHLLAIKPNNLSFAEAASLPLALSTAYQGFE 263 GDEVYG++NE+PL N K G+LAE+TAVEE LLA KP+NLSF EAASLPLA+ TAYQG E Sbjct: 95 GDEVYGDINEDPLDNPKTVGSLAEYTAVEEKLLAHKPSNLSFVEAASLPLAIITAYQGLE 154 >ref|XP_003553854.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Glycine max] Length = 322 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/60 (70%), Positives = 51/60 (85%) Frame = +3 Query: 84 GDEVYGNVNENPLKNCKRSGTLAEFTAVEEHLLAIKPNNLSFAEAASLPLALSTAYQGFE 263 GD VYG++NE+P+ N K G+LAE+TAVEE +LA KP+NLSF EAASLPLA+ TAYQGFE Sbjct: 95 GDGVYGDINEDPVNNPKAIGSLAEYTAVEEKVLAHKPSNLSFVEAASLPLAIITAYQGFE 154 >ref|NP_001151204.1| quinone oxidoreductase-like protein At1g23740 [Zea mays] gi|195644996|gb|ACG41966.1| quinone oxidoreductase-like protein At1g23740 [Zea mays] gi|414870595|tpg|DAA49152.1| TPA: quinone oxidoreductase-like protein At1g23740 [Zea mays] Length = 386 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +3 Query: 81 EGDEVYGNVNENPLKNCKRSGTLAEFTAVEEHLLAIKPNNLSFAEAASLPLALSTAYQGF 260 EGDEVYG V+ENPL+ K+SG+LAE+TAVEE LLA+KP L FA+AASLPLA+ TA +G Sbjct: 160 EGDEVYGMVSENPLQGPKQSGSLAEYTAVEEKLLALKPKGLDFAQAASLPLAVETANEGL 219 Query: 261 E 263 E Sbjct: 220 E 220 >ref|XP_002525379.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223535342|gb|EEF37017.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 389 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 81 EGDEVYGNVNENPLKNCKRSGTLAEFTAVEEHLLAIKPNNLSFAEAASLPLALSTAYQGF 260 EGDEVYG++NE L+ K+ G+LAE+TAVEE LLA+KP NL F +AASLPLA+ TAY+G Sbjct: 163 EGDEVYGDINEKALEGPKQFGSLAEYTAVEEKLLALKPKNLDFVQAASLPLAIETAYEGL 222 Query: 261 E 263 E Sbjct: 223 E 223 >gb|ABK92721.1| unknown [Populus trichocarpa] Length = 322 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +3 Query: 84 GDEVYGNVNENPLKNCKRSGTLAEFTAVEEHLLAIKPNNLSFAEAASLPLALSTAYQGFE 263 GDEVYG++NE L + KR G+LAE+TAVEE+LL++KP NLSFAEAASLPL + TA++G E Sbjct: 97 GDEVYGDINEKALDHPKRFGSLAEYTAVEENLLSLKPKNLSFAEAASLPLVIETAHEGLE 156