BLASTX nr result
ID: Angelica23_contig00024243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024243 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002878992.1| hypothetical protein ARALYDRAFT_481528 [Arab... 61 1e-07 ref|XP_003609372.1| WD repeat-containing protein [Medicago trunc... 60 2e-07 ref|NP_850083.1| Transducin family protein / WD-40 repeat family... 60 2e-07 ref|XP_002527186.1| nucleotide binding protein, putative [Ricinu... 59 5e-07 ref|XP_003541474.1| PREDICTED: WD repeat-containing protein 11-l... 58 7e-07 >ref|XP_002878992.1| hypothetical protein ARALYDRAFT_481528 [Arabidopsis lyrata subsp. lyrata] gi|297324831|gb|EFH55251.1| hypothetical protein ARALYDRAFT_481528 [Arabidopsis lyrata subsp. lyrata] Length = 1253 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 5 RLMAFDQGDLWESANEHINWHEKLEGEEDI*NRVHE 112 RLMAF+Q DLW ANE I WHEKLEGEE I NRVHE Sbjct: 1019 RLMAFEQNDLWVCANERIPWHEKLEGEEAIQNRVHE 1054 >ref|XP_003609372.1| WD repeat-containing protein [Medicago truncatula] gi|355510427|gb|AES91569.1| WD repeat-containing protein [Medicago truncatula] Length = 1581 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 5 RLMAFDQGDLWESANEHINWHEKLEGEEDI*NRVHE 112 RLMAFDQ +LW+SA+E I+WHEKLEGEE I RVHE Sbjct: 1236 RLMAFDQEELWKSASERISWHEKLEGEEAIQKRVHE 1271 >ref|NP_850083.1| Transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|330252773|gb|AEC07867.1| Transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] Length = 1249 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 5 RLMAFDQGDLWESANEHINWHEKLEGEEDI*NRVHE 112 RLMAF+Q DLW ANE I WHEKLEGEE I NRVHE Sbjct: 1015 RLMAFEQKDLWVCANERIPWHEKLEGEEAIQNRVHE 1050 >ref|XP_002527186.1| nucleotide binding protein, putative [Ricinus communis] gi|223533451|gb|EEF35199.1| nucleotide binding protein, putative [Ricinus communis] Length = 1357 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 5 RLMAFDQGDLWESANEHINWHEKLEGEEDI*NRVHE 112 R MAF Q +LWE+ANE I WHEKLEGEE I NRVHE Sbjct: 1102 RSMAFKQEELWENANERIPWHEKLEGEEAIQNRVHE 1137 >ref|XP_003541474.1| PREDICTED: WD repeat-containing protein 11-like [Glycine max] Length = 1252 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 5 RLMAFDQGDLWESANEHINWHEKLEGEEDI*NRVHE 112 RLMAFD+ +LW+SA+E I+WHEKLEGEE I R+HE Sbjct: 1017 RLMAFDREELWKSASERISWHEKLEGEEAIQKRIHE 1052