BLASTX nr result
ID: Angelica23_contig00024134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024134 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150741.1| PREDICTED: B3 domain-containing transcriptio... 128 4e-28 ref|XP_003553973.1| PREDICTED: B3 domain-containing transcriptio... 127 9e-28 ref|XP_003548926.1| PREDICTED: B3 domain-containing transcriptio... 127 9e-28 ref|XP_002512863.1| conserved hypothetical protein [Ricinus comm... 127 1e-27 emb|CBI21292.3| unnamed protein product [Vitis vinifera] 124 6e-27 >ref|XP_004150741.1| PREDICTED: B3 domain-containing transcription factor FUS3-like, partial [Cucumis sativus] gi|449531283|ref|XP_004172616.1| PREDICTED: B3 domain-containing transcription factor FUS3-like, partial [Cucumis sativus] Length = 206 Score = 128 bits (322), Expect = 4e-28 Identities = 56/81 (69%), Positives = 69/81 (85%) Frame = +2 Query: 5 KLKFLFQKQLQNSDVNNLKRMVIPKKAAEAYLPKLDKKGGTYIEMIDIDGSHIWNFIYRF 184 KLKFLFQK+L+NSDV++L+RM++PKKAAE +LP L+ K G I M D+DG H+WNF YRF Sbjct: 6 KLKFLFQKELKNSDVSSLRRMILPKKAAETHLPALESKEGMMITMDDLDGVHVWNFKYRF 65 Query: 185 WPNNKSRMYILENTGEFVNKH 247 WPNN SRMY+LENTG+FVN H Sbjct: 66 WPNNNSRMYVLENTGDFVNAH 86 >ref|XP_003553973.1| PREDICTED: B3 domain-containing transcription factor FUS3-like [Glycine max] Length = 332 Score = 127 bits (319), Expect = 9e-28 Identities = 55/81 (67%), Positives = 70/81 (86%) Frame = +2 Query: 5 KLKFLFQKQLQNSDVNNLKRMVIPKKAAEAYLPKLDKKGGTYIEMIDIDGSHIWNFIYRF 184 +L+FLFQK+L+NSDV++L+RM++PKKAAEA+LP L+ K G I M DIDG H+W+F YRF Sbjct: 139 RLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKYRF 198 Query: 185 WPNNKSRMYILENTGEFVNKH 247 WPNN SRMY+LENTG+FVN H Sbjct: 199 WPNNNSRMYVLENTGDFVNTH 219 >ref|XP_003548926.1| PREDICTED: B3 domain-containing transcription factor FUS3-like [Glycine max] Length = 338 Score = 127 bits (319), Expect = 9e-28 Identities = 55/81 (67%), Positives = 70/81 (86%) Frame = +2 Query: 5 KLKFLFQKQLQNSDVNNLKRMVIPKKAAEAYLPKLDKKGGTYIEMIDIDGSHIWNFIYRF 184 +L+FLFQK+L+NSDV++L+RM++PKKAAEA+LP L+ K G I M DIDG H+W+F YRF Sbjct: 145 RLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKYRF 204 Query: 185 WPNNKSRMYILENTGEFVNKH 247 WPNN SRMY+LENTG+FVN H Sbjct: 205 WPNNNSRMYVLENTGDFVNTH 225 >ref|XP_002512863.1| conserved hypothetical protein [Ricinus communis] gi|223547874|gb|EEF49366.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 127 bits (318), Expect = 1e-27 Identities = 55/81 (67%), Positives = 70/81 (86%) Frame = +2 Query: 5 KLKFLFQKQLQNSDVNNLKRMVIPKKAAEAYLPKLDKKGGTYIEMIDIDGSHIWNFIYRF 184 +L FLFQK+L+NSDV++LKRMV+PKKAAEA+LP L+ K G +I M D+DG H+W+F YR+ Sbjct: 127 RLSFLFQKELKNSDVSSLKRMVLPKKAAEAHLPVLESKEGIFISMDDLDGLHVWSFKYRY 186 Query: 185 WPNNKSRMYILENTGEFVNKH 247 WPNN SRMY+LENTG+FVN H Sbjct: 187 WPNNNSRMYVLENTGDFVNTH 207 >emb|CBI21292.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 124 bits (312), Expect = 6e-27 Identities = 54/80 (67%), Positives = 67/80 (83%) Frame = +2 Query: 8 LKFLFQKQLQNSDVNNLKRMVIPKKAAEAYLPKLDKKGGTYIEMIDIDGSHIWNFIYRFW 187 L+FLF+K+L+NSDV +L+RMV+PKK+AE +LP L+ K G I M D+DG H+WNF YRFW Sbjct: 91 LRFLFEKELKNSDVGSLRRMVLPKKSAETHLPLLEAKEGILITMYDLDGQHVWNFKYRFW 150 Query: 188 PNNKSRMYILENTGEFVNKH 247 PNN SRMY+LENTGEFVN H Sbjct: 151 PNNNSRMYVLENTGEFVNVH 170