BLASTX nr result
ID: Angelica23_contig00024058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00024058 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15774.3| unnamed protein product [Vitis vinifera] 76 2e-12 ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial car... 76 2e-12 emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] 76 2e-12 ref|XP_002277297.1| PREDICTED: calcium-binding mitochondrial car... 75 7e-12 ref|XP_003548488.1| PREDICTED: calcium-binding mitochondrial car... 73 2e-11 >emb|CBI15774.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 440 EGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 327 EG RGFYKGLFPNLLKVVP+ASITYLVYETMKKSLDLD Sbjct: 472 EGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 509 >ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Vitis vinifera] Length = 511 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 440 EGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 327 EG RGFYKGLFPNLLKVVP+ASITYLVYETMKKSLDLD Sbjct: 474 EGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 511 >emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] Length = 496 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 440 EGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 327 EG RGFYKGLFPNLLKVVP+ASITYLVYETMKKSLDLD Sbjct: 459 EGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 496 >ref|XP_002277297.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 [Vitis vinifera] gi|296082251|emb|CBI21256.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 440 EGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 327 EG RGFYKGLFPNLLKVVP+ASITYLVYETMKKSL+LD Sbjct: 452 EGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLELD 489 >ref|XP_003548488.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Glycine max] Length = 473 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -3 Query: 440 EGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 327 EGLRGFYKG+FPNLLKVVP+ASITY+VYE+MKKSLDL+ Sbjct: 436 EGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDLE 473