BLASTX nr result
ID: Angelica23_contig00023692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00023692 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] 55 4e-06 gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays... 55 4e-06 ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 55 4e-06 ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 55 4e-06 ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 55 4e-06 >gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] Length = 344 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 VGRAGRFGTKGLAITCVSSTSDSDVLNQVVPVFKLQL 111 VGRAGRFGTKGLAIT VSS SDSDVLNQV F++ + Sbjct: 293 VGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDI 329 >gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays] gi|413948694|gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays] gi|413948695|gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays] Length = 429 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 VGRAGRFGTKGLAITCVSSTSDSDVLNQVVPVFKLQL 111 VGRAGRFGTKGLAIT VSS SDSDVLNQV F++ + Sbjct: 378 VGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDI 414 >ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 VGRAGRFGTKGLAITCVSSTSDSDVLNQVVPVFKLQL 111 VGRAGRFGTKGLAIT VSS SDSDVLNQV F++ + Sbjct: 377 VGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDI 413 >ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 429 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 VGRAGRFGTKGLAITCVSSTSDSDVLNQVVPVFKLQL 111 VGRAGRFGTKGLAIT VSS SDSDVLNQV F++ + Sbjct: 378 VGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDI 414 >ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 VGRAGRFGTKGLAITCVSSTSDSDVLNQVVPVFKLQL 111 VGRAGRFGTKGLAIT VSS SDSDVLNQV F++ + Sbjct: 377 VGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDI 413