BLASTX nr result
ID: Angelica23_contig00023620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00023620 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156282.1| PREDICTED: LOW QUALITY PROTEIN: cell divisio... 99 3e-19 ref|XP_004143268.1| PREDICTED: cell division cycle protein 48 ho... 99 3e-19 tpg|DAA43414.1| TPA: hypothetical protein ZEAMMB73_941156, parti... 99 3e-19 gb|AFW89668.1| hypothetical protein ZEAMMB73_027527 [Zea mays] 99 3e-19 ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 ho... 99 3e-19 >ref|XP_004156282.1| PREDICTED: LOW QUALITY PROTEIN: cell division cycle protein 48 homolog [Cucumis sativus] Length = 807 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 170 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 313 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL Sbjct: 353 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 400 >ref|XP_004143268.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] Length = 807 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 170 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 313 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL Sbjct: 353 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 400 >tpg|DAA43414.1| TPA: hypothetical protein ZEAMMB73_941156, partial [Zea mays] Length = 453 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 170 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 313 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL Sbjct: 354 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 401 >gb|AFW89668.1| hypothetical protein ZEAMMB73_027527 [Zea mays] Length = 804 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 170 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 313 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL Sbjct: 354 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 401 >ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Length = 808 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 170 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 313 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL Sbjct: 353 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLAEDVDL 400