BLASTX nr result
ID: Angelica23_contig00023055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00023055 (614 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEC11043.1| dolichyl-phosphate beta-d-mannosyltransferase [Ca... 60 4e-07 gb|AAF79605.1|AC027665_6 F5M15.10 [Arabidopsis thaliana] 59 9e-07 ref|XP_002893120.1| hypothetical protein ARALYDRAFT_889509 [Arab... 59 9e-07 gb|AAM63196.1| unknown [Arabidopsis thaliana] 59 9e-07 ref|NP_564118.1| dolichol-phosphate mannosyltransferase [Arabido... 59 9e-07 >gb|AEC11043.1| dolichyl-phosphate beta-d-mannosyltransferase [Camellia sinensis] Length = 93 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 344 KDIISSCVSKGYVFKMKMIVSASRKGYHIEEV 439 +D+ISSCVSKGYVF+M+MIV ASRKGYHIEEV Sbjct: 14 EDVISSCVSKGYVFQMEMIVRASRKGYHIEEV 45 >gb|AAF79605.1|AC027665_6 F5M15.10 [Arabidopsis thaliana] Length = 256 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 344 KDIISSCVSKGYVFKMKMIVSASRKGYHIEEV 439 +D+ISSCVSKGYVF+M+MIV A+RKGYHIEEV Sbjct: 192 EDVISSCVSKGYVFQMEMIVRATRKGYHIEEV 223 >ref|XP_002893120.1| hypothetical protein ARALYDRAFT_889509 [Arabidopsis lyrata subsp. lyrata] gi|297338962|gb|EFH69379.1| hypothetical protein ARALYDRAFT_889509 [Arabidopsis lyrata subsp. lyrata] Length = 246 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 344 KDIISSCVSKGYVFKMKMIVSASRKGYHIEEV 439 +D+ISSCVSKGYVF+M+MIV A+RKGYHIEEV Sbjct: 182 EDVISSCVSKGYVFQMEMIVRATRKGYHIEEV 213 >gb|AAM63196.1| unknown [Arabidopsis thaliana] Length = 242 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 344 KDIISSCVSKGYVFKMKMIVSASRKGYHIEEV 439 +D+ISSCVSKGYVF+M+MIV A+RKGYHIEEV Sbjct: 178 EDVISSCVSKGYVFQMEMIVRATRKGYHIEEV 209 >ref|NP_564118.1| dolichol-phosphate mannosyltransferase [Arabidopsis thaliana] gi|8886954|gb|AAF80640.1|AC069251_33 F2D10.6 [Arabidopsis thaliana] gi|29028862|gb|AAO64810.1| At1g20575 [Arabidopsis thaliana] gi|51969260|dbj|BAD43322.1| hypothetical protein [Arabidopsis thaliana] gi|110743122|dbj|BAE99453.1| hypothetical protein [Arabidopsis thaliana] gi|332191868|gb|AEE29989.1| dolichol-phosphate mannosyltransferase [Arabidopsis thaliana] Length = 246 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 344 KDIISSCVSKGYVFKMKMIVSASRKGYHIEEV 439 +D+ISSCVSKGYVF+M+MIV A+RKGYHIEEV Sbjct: 182 EDVISSCVSKGYVFQMEMIVRATRKGYHIEEV 213