BLASTX nr result
ID: Angelica23_contig00022895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00022895 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001767617.1| predicted protein [Physcomitrella patens sub... 67 2e-09 ref|XP_001755416.1| predicted protein [Physcomitrella patens sub... 66 3e-09 ref|XP_001774433.1| predicted protein [Physcomitrella patens sub... 66 3e-09 gb|ACN40032.1| unknown [Picea sitchensis] 65 4e-09 dbj|BAJ92458.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 1e-08 >ref|XP_001767617.1| predicted protein [Physcomitrella patens subsp. patens] gi|162681146|gb|EDQ67576.1| predicted protein [Physcomitrella patens subsp. patens] Length = 556 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL GC SLEALP +G + SL KLY++G +L+ LP+S+ +L SL L + C Sbjct: 102 LNSLVKLDLYGCESLEALPESMGNLNSLVKLYLHGCRSLKALPESMGNLNSLVELDLRGC 161 Query: 47 KKLKILPEVYSNL 9 + L+ LPE NL Sbjct: 162 ESLEALPESMGNL 174 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/73 (47%), Positives = 46/73 (63%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L+L GC SLEALP +G + SL KL + G E+L LP+S+ +L SL L + C Sbjct: 78 LNSLVELNLGGCESLEALPESMGNLNSLVKLDLYGCESLEALPESMGNLNSLVKLYLHGC 137 Query: 47 KKLKILPEVYSNL 9 + LK LPE NL Sbjct: 138 RSLKALPESMGNL 150 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/73 (43%), Positives = 45/73 (61%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL GC SL+ALP + + SL +L + G E+L LP+S+ +L SL L + C Sbjct: 54 LNSLVELDLGGCESLDALPESMDNLNSLVELNLGGCESLEALPESMGNLNSLVKLDLYGC 113 Query: 47 KKLKILPEVYSNL 9 + L+ LPE NL Sbjct: 114 ESLEALPESMGNL 126 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/74 (44%), Positives = 46/74 (62%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL GC SL+ALP +G + SL +L + G +L LP+S+ +L SL L + C Sbjct: 174 LNSLVELDLYGCGSLKALPESMGNLNSLVELNLYGCGSLEALPESMGNLNSLVKLDLRGC 233 Query: 47 KKLKILPEVYSNLE 6 K L+ LPE NL+ Sbjct: 234 KTLEALPESIGNLK 247 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/73 (45%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L L GC SL+ALP +G + SL +L + G E+L LP+S+ +L SL L + C Sbjct: 126 LNSLVKLYLHGCRSLKALPESMGNLNSLVELDLRGCESLEALPESMGNLNSLVELDLYGC 185 Query: 47 KKLKILPEVYSNL 9 LK LPE NL Sbjct: 186 GSLKALPESMGNL 198 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/73 (45%), Positives = 45/73 (61%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL GC SLEALP +G + SL +L + G +L+ LP+S+ +L SL L + C Sbjct: 150 LNSLVELDLRGCESLEALPESMGNLNSLVELDLYGCGSLKALPESMGNLNSLVELNLYGC 209 Query: 47 KKLKILPEVYSNL 9 L+ LPE NL Sbjct: 210 GSLEALPESMGNL 222 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/73 (46%), Positives = 43/73 (58%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL C SL+ALP +G + SL KL + G +L LP+SI +L SL L + C Sbjct: 269 LNSLVKLDLRVCKSLKALPESIGNLNSLVKLNLYGCRSLEALPESIGNLNSLVDLNLYGC 328 Query: 47 KKLKILPEVYSNL 9 LK LPE NL Sbjct: 329 VSLKALPESIGNL 341 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/73 (46%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L+L GC SLEALP +G + SL L + G +L+ LP+SI +L SL L + C Sbjct: 293 LNSLVKLNLYGCRSLEALPESIGNLNSLVDLNLYGCVSLKALPESIGNLNSLLDLYLYTC 352 Query: 47 KKLKILPEVYSNL 9 LK LPE NL Sbjct: 353 GSLKALPESIGNL 365 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/73 (42%), Positives = 43/73 (58%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L L + C SL+ALP +G + SL KLY+ G +L+ LP+S+ +L SL L + C Sbjct: 6 LHKLVSLHVADCRSLKALPKSMGNLNSLVKLYLYGCRSLKALPESMGNLNSLVELDLGGC 65 Query: 47 KKLKILPEVYSNL 9 + L LPE NL Sbjct: 66 ESLDALPESMDNL 78 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/73 (43%), Positives = 45/73 (61%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L L GC SL+ALP +G + SL +L + G E+L LP+S+ +L SL L + C Sbjct: 30 LNSLVKLYLYGCRSLKALPESMGNLNSLVELDLGGCESLDALPESMDNLNSLVELNLGGC 89 Query: 47 KKLKILPEVYSNL 9 + L+ LPE NL Sbjct: 90 ESLEALPESMGNL 102 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/73 (45%), Positives = 43/73 (58%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L+L GC SLEAL +G + SL L + G +L+ LP+SI +L SL L + C Sbjct: 413 LNSLVKLNLYGCQSLEALQESIGNLNSLVDLNLYGCVSLKALPESIGNLNSLMDLDLYTC 472 Query: 47 KKLKILPEVYSNL 9 LK LPE NL Sbjct: 473 GSLKALPESIGNL 485 Score = 55.8 bits (133), Expect = 4e-06 Identities = 33/73 (45%), Positives = 42/73 (57%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL C SL+ALP +G + SL K + ++L LP SI +L SL L + C Sbjct: 461 LNSLMDLDLYTCGSLKALPESIGNLNSLVKFNLGVCQSLEALPKSIGNLNSLVKLDLRVC 520 Query: 47 KKLKILPEVYSNL 9 K LK LPE NL Sbjct: 521 KSLKALPESIGNL 533 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/71 (45%), Positives = 42/71 (59%) Frame = -2 Query: 221 ALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQCKK 42 +L LDL C SL+ALP +G + SL KL + G ++L L +SI +L SL L + C Sbjct: 391 SLVKLDLRVCKSLKALPESIGNLNSLVKLNLYGCQSLEALQESIGNLNSLVDLNLYGCVS 450 Query: 41 LKILPEVYSNL 9 LK LPE NL Sbjct: 451 LKALPESIGNL 461 >ref|XP_001755416.1| predicted protein [Physcomitrella patens subsp. patens] gi|162693544|gb|EDQ79896.1| predicted protein [Physcomitrella patens subsp. patens] Length = 624 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/73 (43%), Positives = 46/73 (63%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L++L D+ GCM+L +LP ELG + +L LYM+G NL +LP + +L SL T I +C Sbjct: 22 LKSLTTFDISGCMNLTSLPKELGNLTTLTSLYMSGCANLTSLPKELGNLTSLTTFDIERC 81 Query: 47 KKLKILPEVYSNL 9 + L LP+ NL Sbjct: 82 ENLTSLPKELGNL 94 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/73 (42%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L VL + GC +L +LP ELG + +L LY++G ENL +LP + +L SL ++ C Sbjct: 118 LTTLTVLYMSGCENLTSLPKELGNLTTLTSLYISGCENLTSLPKELGNLTSLTIFYMSYC 177 Query: 47 KKLKILPEVYSNL 9 K L LP+ NL Sbjct: 178 KNLTSLPKELGNL 190 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/73 (41%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L++ D+ C +L +LP ELG + +L LYM+G NL LP + +L SL T I +C Sbjct: 502 LTSLKIFDMSWCENLTSLPKELGNLTTLTSLYMSGCVNLTLLPKELSNLTSLTTFDIERC 561 Query: 47 KKLKILPEVYSNL 9 + L LP+ NL Sbjct: 562 ENLTSLPKELGNL 574 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/73 (39%), Positives = 45/73 (61%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 + +L +L + GC +L +LP ELG + SL LYM+G NL +LP + +L SL+ ++ C Sbjct: 382 ITSLTLLCMSGCANLTSLPKELGNLTSLISLYMSGCANLTSLPKELGNLTSLKIFDMSWC 441 Query: 47 KKLKILPEVYSNL 9 + L LP+ NL Sbjct: 442 ENLTSLPKELGNL 454 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/73 (39%), Positives = 45/73 (61%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L ++ C +L +LP ELG + +L LYM+G ENL +LP + +L +L +L I+ C Sbjct: 94 LTSLTKFNMSRCKNLTSLPKELGNLTTLTVLYMSGCENLTSLPKELGNLTTLTSLYISGC 153 Query: 47 KKLKILPEVYSNL 9 + L LP+ NL Sbjct: 154 ENLTSLPKELGNL 166 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/73 (39%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L++ D+ C +L +LP ELG + SL LYM+ NL +LP + +L SL +L ++ C Sbjct: 430 LTSLKIFDMSWCENLTSLPKELGNLTSLTSLYMSRCANLTSLPKELGNLTSLISLYMSGC 489 Query: 47 KKLKILPEVYSNL 9 L LP+ NL Sbjct: 490 ANLTSLPKELGNL 502 >ref|XP_001774433.1| predicted protein [Physcomitrella patens subsp. patens] gi|162674285|gb|EDQ60796.1| predicted protein [Physcomitrella patens subsp. patens] Length = 513 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/74 (44%), Positives = 49/74 (66%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L +LDL GC +L +LP ELG + SL L +NG+ NL +LP+ + +L SL +L I++C Sbjct: 351 LTSLILLDLSGCSNLTSLPNELGNLTSLTSLNINGSSNLTSLPNELGNLTSLTSLHISEC 410 Query: 47 KKLKILPEVYSNLE 6 +L LP NL+ Sbjct: 411 MRLTSLPNELGNLK 424 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/73 (42%), Positives = 43/73 (58%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L LDL GC +L +LP EL + SL L +NG +L +LP+ + +L SL +L I +C Sbjct: 87 LTSLISLDLSGCSNLTSLPNELDNLTSLTSLNINGCSSLTSLPNELGNLTSLTSLNINEC 146 Query: 47 KKLKILPEVYSNL 9 L LP NL Sbjct: 147 SSLTSLPNELGNL 159 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/73 (42%), Positives = 42/73 (57%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L +L L+L GC SL +LP ELG + SL L ++G NL +LP+ + + SL +L I C Sbjct: 183 LASLTSLNLSGCPSLTSLPNELGNLTSLISLDLSGCSNLTSLPNELDNFTSLTSLNINGC 242 Query: 47 KKLKILPEVYSNL 9 L LP NL Sbjct: 243 SSLTSLPNELGNL 255 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/67 (43%), Positives = 41/67 (61%) Frame = -2 Query: 209 LDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQCKKLKIL 30 L+L GC SL +LP ELG + SL L ++G NL +LP+ + +L SL +L ++ C L L Sbjct: 21 LNLSGCSSLTSLPNELGNLTSLISLDISGCSNLISLPNELHNLASLTSLNLSGCSNLTSL 80 Query: 29 PEVYSNL 9 P NL Sbjct: 81 PNELDNL 87 >gb|ACN40032.1| unknown [Picea sitchensis] Length = 1071 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/73 (41%), Positives = 47/73 (64%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L++L+ LDLDGC +L+ LP +G + L+ L ++G L+ LPDS +L L+TL + C Sbjct: 876 LKSLQTLDLDGCSTLQTLPDSVGNLTGLQTLNLSGCSTLQTLPDSFGNLTGLQTLNLIGC 935 Query: 47 KKLKILPEVYSNL 9 L+ LP+ + NL Sbjct: 936 STLQTLPDSFGNL 948 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/74 (39%), Positives = 47/74 (63%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ L L GC +L+ LP +G + L+ LY++G L+ LPDS+ +L L+TL + +C Sbjct: 804 LTGLQTLYLSGCSTLQTLPDSVGNLTGLQTLYLSGCSTLQTLPDSVGNLTGLQTLNLDRC 863 Query: 47 KKLKILPEVYSNLE 6 L+ LP++ NL+ Sbjct: 864 STLQTLPDLVGNLK 877 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/73 (39%), Positives = 48/73 (65%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ L+LD C +L+ LP +G ++SL+ L ++G L+ LPDS+ +L L+TL ++ C Sbjct: 852 LTGLQTLNLDRCSTLQTLPDLVGNLKSLQTLDLDGCSTLQTLPDSVGNLTGLQTLNLSGC 911 Query: 47 KKLKILPEVYSNL 9 L+ LP+ + NL Sbjct: 912 STLQTLPDSFGNL 924 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/73 (38%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ L L C +L+ LP +G + L+ LY++G L+ LPDS+ +L L+TL ++ C Sbjct: 780 LTGLQTLYLSRCSTLQTLPDSVGNLTGLQTLYLSGCSTLQTLPDSVGNLTGLQTLYLSGC 839 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 840 STLQTLPDSVGNL 852 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/73 (38%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ LDL C +L+ LP +G + L+ LY++ L+ LPDS+ +L L+TL ++ C Sbjct: 756 LTGLQTLDLIECSTLQTLPDSVGNLTGLQTLYLSRCSTLQTLPDSVGNLTGLQTLYLSGC 815 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 816 STLQTLPDSVGNL 828 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/73 (39%), Positives = 44/73 (60%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ LDL GC +L+ LP +G + L+KL ++ L+ LPDS+ +L L+TL + C Sbjct: 684 LTGLQTLDLIGCSTLQMLPDSVGNLTGLQKLDLSWCSTLQMLPDSVGNLTGLQTLALGWC 743 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 744 STLQTLPDSVGNL 756 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ L+L GC +L+ LP G + L+ L + G L+ LPDS +L L+TL + C Sbjct: 900 LTGLQTLNLSGCSTLQTLPDSFGNLTGLQTLNLIGCSTLQTLPDSFGNLTGLQTLNLIGC 959 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 960 STLQTLPDSVGNL 972 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ LDL C +L+ LP +G + L+ L + L+ LPDS+ +L L+TL + +C Sbjct: 708 LTGLQKLDLSWCSTLQMLPDSVGNLTGLQTLALGWCSTLQTLPDSVGNLTGLQTLDLIEC 767 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 768 STLQTLPDSVGNL 780 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/73 (36%), Positives = 43/73 (58%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ L L GC +L+ LP +G + L+ L ++ L+ LPD + +L+SL+TL + C Sbjct: 828 LTGLQTLYLSGCSTLQTLPDSVGNLTGLQTLNLDRCSTLQTLPDLVGNLKSLQTLDLDGC 887 Query: 47 KKLKILPEVYSNL 9 L+ LP+ NL Sbjct: 888 STLQTLPDSVGNL 900 >dbj|BAJ92458.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 876 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/74 (39%), Positives = 50/74 (67%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L+ L+ LDL GC LE+LP LG +++L+++++ L LP+S+ L++L+TL ++ C Sbjct: 726 LKTLQTLDLSGCGKLESLPESLGSLKTLQRMHLFACHKLEFLPESLGGLKNLQTLDLSHC 785 Query: 47 KKLKILPEVYSNLE 6 KL+ LPE +L+ Sbjct: 786 DKLESLPESLGSLQ 799 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/74 (40%), Positives = 48/74 (64%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L+ LDL GC LE+LP LG +++L+ L ++G L +LP+S+ SL++L+ + + C Sbjct: 702 LNNLDTLDLSGCRKLESLPKSLGSLKTLQTLDLSGCGKLESLPESLGSLKTLQRMHLFAC 761 Query: 47 KKLKILPEVYSNLE 6 KL+ LPE L+ Sbjct: 762 HKLEFLPESLGGLK 775 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/74 (39%), Positives = 50/74 (67%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L LDL GC LE+LP LG +E+++ L ++ + L++LP+ + SL +L+TL ++ C Sbjct: 654 LNNLRTLDLSGCQKLESLPESLGSLENIQTLDLSVCDELKSLPECLGSLNNLDTLDLSGC 713 Query: 47 KKLKILPEVYSNLE 6 +KL+ LP+ +L+ Sbjct: 714 RKLESLPKSLGSLK 727 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/74 (39%), Positives = 48/74 (64%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L+ L+ LDL C LE+LP LG +++L ++ L++LP+S+ L++L+TL +T C Sbjct: 774 LKNLQTLDLSHCDKLESLPESLGSLQNLYTFDLSSCFELKSLPESLGGLKNLQTLDLTFC 833 Query: 47 KKLKILPEVYSNLE 6 +LK LPE +L+ Sbjct: 834 HRLKDLPESLESLK 847 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/74 (39%), Positives = 47/74 (63%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L L L+L+G + A+P + K+ESL LY+ +++ +PDS+ SL +L TL ++ C Sbjct: 606 LSRLHYLNLNGSREISAIPSSVSKLESLVHLYLAYCTSVKVIPDSLGSLNNLRTLDLSGC 665 Query: 47 KKLKILPEVYSNLE 6 +KL+ LPE +LE Sbjct: 666 QKLESLPESLGSLE 679 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/74 (39%), Positives = 47/74 (63%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L ++ LDL C L++LP LG + +L L ++G L +LP S+ SL++L+TL ++ C Sbjct: 678 LENIQTLDLSVCDELKSLPECLGSLNNLDTLDLSGCRKLESLPKSLGSLKTLQTLDLSGC 737 Query: 47 KKLKILPEVYSNLE 6 KL+ LPE +L+ Sbjct: 738 GKLESLPESLGSLK 751 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/74 (37%), Positives = 48/74 (64%) Frame = -2 Query: 227 LRALEVLDLDGCMSLEALPLELGKIESLKKLYMNGNENLRNLPDSICSLRSLETLQITQC 48 L+ L DL C L++LP LG +++L+ L + L++LP+S+ SL++L+TL ++ C Sbjct: 798 LQNLYTFDLSSCFELKSLPESLGGLKNLQTLDLTFCHRLKDLPESLESLKNLQTLNLSGC 857 Query: 47 KKLKILPEVYSNLE 6 +LK LP+ NL+ Sbjct: 858 YRLKSLPKGPENLK 871