BLASTX nr result
ID: Angelica23_contig00022705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00022705 (660 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC35333.1| N2-C protein [Linum usitatissimum] 60 5e-07 emb|CAC35337.1| Nbi-C protein [Linum usitatissimum] 60 5e-07 emb|CAC35329.1| N1-C protein [Linum usitatissimum] 60 5e-07 emb|CAC35330.1| N1-D protein [Linum usitatissimum] 58 1e-06 emb|CAC35326.1| Ngc-C protein [Linum usitatissimum] 58 2e-06 >emb|CAC35333.1| N2-C protein [Linum usitatissimum] Length = 1119 Score = 59.7 bits (143), Expect = 5e-07 Identities = 36/89 (40%), Positives = 49/89 (55%) Frame = +2 Query: 2 LEEVTSLEYLSLSNCRSMEVLPNLCKLKHLKRLDLTDCDGLKVITGLEYLEFGYCGKSVS 181 L+ + SLEYLSLS C+S+ +P+L +K LK LD+ C LK + GLE LE Sbjct: 979 LDTLESLEYLSLSGCQSIRKVPDLSGMKKLKTLDVEGCIQLKEVEGLERLE--------- 1029 Query: 182 KLPPILKWVDAHGCTSLKRLPNRSNWKQL 268 L+ + GC S++ LPN S K L Sbjct: 1030 ----SLEELKMSGCKSIEELPNLSGLKNL 1054 >emb|CAC35337.1| Nbi-C protein [Linum usitatissimum] Length = 1107 Score = 59.7 bits (143), Expect = 5e-07 Identities = 36/89 (40%), Positives = 49/89 (55%) Frame = +2 Query: 2 LEEVTSLEYLSLSNCRSMEVLPNLCKLKHLKRLDLTDCDGLKVITGLEYLEFGYCGKSVS 181 L+ + SLEYLSLS C+S+ +P+L +K LK LD+ C LK + GLE LE Sbjct: 967 LDTLESLEYLSLSGCQSIRKVPDLSGMKKLKTLDVEGCIQLKEVEGLERLE--------- 1017 Query: 182 KLPPILKWVDAHGCTSLKRLPNRSNWKQL 268 L+ + GC S++ LPN S K L Sbjct: 1018 ----SLEELKMSGCKSIEELPNLSGLKNL 1042 >emb|CAC35329.1| N1-C protein [Linum usitatissimum] Length = 1120 Score = 59.7 bits (143), Expect = 5e-07 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +2 Query: 2 LEEVTSLEYLSLSNCRSMEVLPNLCKLKHLKRLDLTDCDGLKVITGLEYLEFGYCGKSVS 181 L+ + SLEYL L+ C S+ LP+L LK LK+LD+ C LK + GLE LE Sbjct: 980 LDALESLEYLFLNGCLSIRKLPDLSGLKKLKKLDVEGCIQLKEVRGLERLE--------- 1030 Query: 182 KLPPILKWVDAHGCTSLKRLPNRSNWKQL 268 L+ ++ GC S+++LPN S K L Sbjct: 1031 ----SLEELNMSGCESIEKLPNLSGLKNL 1055 >emb|CAC35330.1| N1-D protein [Linum usitatissimum] Length = 1108 Score = 58.2 bits (139), Expect = 1e-06 Identities = 35/89 (39%), Positives = 48/89 (53%) Frame = +2 Query: 2 LEEVTSLEYLSLSNCRSMEVLPNLCKLKHLKRLDLTDCDGLKVITGLEYLEFGYCGKSVS 181 L+ + SLE+LS+ CRS+ +P+L LK LK LD+ C LK + GLE LE Sbjct: 980 LDALESLEWLSMEGCRSIRKVPDLSGLKKLKTLDVESCIQLKEVRGLERLE--------- 1030 Query: 182 KLPPILKWVDAHGCTSLKRLPNRSNWKQL 268 L+ + GC S++ LPN S K L Sbjct: 1031 ----SLEELKMSGCESIEELPNLSGLKNL 1055 >emb|CAC35326.1| Ngc-C protein [Linum usitatissimum] Length = 1120 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/89 (38%), Positives = 51/89 (57%) Frame = +2 Query: 2 LEEVTSLEYLSLSNCRSMEVLPNLCKLKHLKRLDLTDCDGLKVITGLEYLEFGYCGKSVS 181 L+ + S+EYL L+ C+S+ +P+L LK LK LD+ C LK + GLE LE Sbjct: 980 LDTLESMEYLYLNGCQSIRKVPDLSGLKKLKTLDVEGCIQLKEVGGLERLE--------- 1030 Query: 182 KLPPILKWVDAHGCTSLKRLPNRSNWKQL 268 L+ ++ GC S+++LPN S K+L Sbjct: 1031 ----SLEELNMSGCESIEKLPNLSGLKKL 1055