BLASTX nr result
ID: Angelica23_contig00022447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00022447 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322522.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 60 2e-07 ref|XP_002308787.1| f-box family protein [Populus trichocarpa] g... 58 7e-07 >ref|XP_002322522.1| predicted protein [Populus trichocarpa] gi|222867152|gb|EEF04283.1| predicted protein [Populus trichocarpa] Length = 419 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 6/76 (7%) Frame = +3 Query: 3 KLMWYDPKRKRAKNVRIRGIPNNFYSYLYTESLLQLAED-----KPLQKPSQDKQLMK-Q 164 KL+WYD K K AK V+IRG PN++ S +Y ESL+++ + K Q+ ++++ K Sbjct: 344 KLVWYDWKNKHAKVVKIRGGPNSYGSEMYVESLVRINDGDRNGWKKQQEIDEEEEKRKAD 403 Query: 165 QKKRDDFLSRGFSLKL 212 +KKRD+FLS GF LKL Sbjct: 404 RKKRDNFLSVGFKLKL 419 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/69 (43%), Positives = 42/69 (60%) Frame = +3 Query: 6 LMWYDPKRKRAKNVRIRGIPNNFYSYLYTESLLQLAEDKPLQKPSQDKQLMKQQKKRDDF 185 L WYD KRK NV I+G+P F + + SL+ L ++ ++P + + K +KKRDDF Sbjct: 321 LFWYDLKRKEVVNVWIQGVPITFEAEICVGSLVPLNANRLRRRPKHEHKETKNRKKRDDF 380 Query: 186 LSRGFSLKL 212 LS GF L L Sbjct: 381 LSEGFKLVL 389 >ref|XP_002308787.1| f-box family protein [Populus trichocarpa] gi|222854763|gb|EEE92310.1| f-box family protein [Populus trichocarpa] Length = 396 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +3 Query: 6 LMWYDPKRKRAKNVRIRGIPNNFYSYLYTESLLQLAEDKPLQKPSQDK-QLMKQQKKRDD 182 L WYD KRK+ KN RI GIP +F + + ESL+ ++ ++ L +QD + K + KRDD Sbjct: 328 LCWYDLKRKQVKN-RIPGIPYSFEADTFVESLISVSPNRHLDGRTQDDDEDSKDRNKRDD 386 Query: 183 FLSRGFSLKL 212 FLS GF L L Sbjct: 387 FLSEGFKLVL 396