BLASTX nr result
ID: Angelica23_contig00022409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00022409 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat... 53 3e-10 emb|CBI18084.3| unnamed protein product [Vitis vinifera] 53 3e-10 ref|XP_004172298.1| PREDICTED: putative pentatricopeptide repeat... 52 2e-06 ref|XP_004137894.1| PREDICTED: putative pentatricopeptide repeat... 52 2e-06 >ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Vitis vinifera] Length = 686 Score = 52.8 bits (125), Expect(2) = 3e-10 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -1 Query: 126 LDQDN*LINMFLKSTFSFSNQSYARLVFNQTHQPNVFLWNT 4 L DN L+NM L+ +F FS+ +Y R +F+Q QPN+FLWNT Sbjct: 42 LCHDNYLLNMILRCSFDFSDTNYTRFLFHQIKQPNIFLWNT 82 Score = 36.6 bits (83), Expect(2) = 3e-10 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -3 Query: 211 MKVKPEGVRDFNSFRHLKQVHTRLLRFGL 125 +++K ++ FNSF+HLK +H LLRFGL Sbjct: 14 LEIKKLILQGFNSFKHLKHLHAHLLRFGL 42 >emb|CBI18084.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 52.8 bits (125), Expect(2) = 3e-10 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -1 Query: 126 LDQDN*LINMFLKSTFSFSNQSYARLVFNQTHQPNVFLWNT 4 L DN L+NM L+ +F FS+ +Y R +F+Q QPN+FLWNT Sbjct: 42 LCHDNYLLNMILRCSFDFSDTNYTRFLFHQIKQPNIFLWNT 82 Score = 36.6 bits (83), Expect(2) = 3e-10 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -3 Query: 211 MKVKPEGVRDFNSFRHLKQVHTRLLRFGL 125 +++K ++ FNSF+HLK +H LLRFGL Sbjct: 14 LEIKKLILQGFNSFKHLKHLHAHLLRFGL 42 >ref|XP_004172298.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Cucumis sativus] Length = 688 Score = 52.4 bits (124), Expect(2) = 2e-06 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = -1 Query: 132 LVLDQDN*LINMFLKSTFSFSNQSYARLVFNQTHQPNVFLWNT 4 L LDQDN L+N+ L F + +Y++LVF+Q +PN+FLWNT Sbjct: 42 LHLDQDNYLLNLILCCALDFGSTNYSKLVFSQVKEPNIFLWNT 84 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 178 NSFRHLKQVHTRLLRFGL 125 N F LK +H RLLR L Sbjct: 27 NFFNQLKHIHARLLRLHL 44 >ref|XP_004137894.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Cucumis sativus] Length = 688 Score = 52.4 bits (124), Expect(2) = 2e-06 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = -1 Query: 132 LVLDQDN*LINMFLKSTFSFSNQSYARLVFNQTHQPNVFLWNT 4 L LDQDN L+N+ L F + +Y++LVF+Q +PN+FLWNT Sbjct: 42 LHLDQDNYLLNLILCCALDFGSTNYSKLVFSQVKEPNIFLWNT 84 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 178 NSFRHLKQVHTRLLRFGL 125 N F LK +H RLLR L Sbjct: 27 NFFNQLKHIHARLLRLHL 44