BLASTX nr result
ID: Angelica23_contig00022076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00022076 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicu... 86 4e-15 gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prun... 86 4e-15 ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isof... 85 7e-15 ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isof... 85 7e-15 emb|CBI19831.3| unnamed protein product [Vitis vinifera] 85 7e-15 >ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicum] gi|300253180|gb|ADJ96592.1| auxin response factor 5 [Solanum lycopersicum] gi|310697420|gb|ADP06665.1| auxin response factor 5 [Solanum lycopersicum] Length = 930 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 395 DDPWEEFVGCVRCIRILSPSEVQQMGEEGMQLLNSTAAQGINGS 264 DDPWEEFVGCVRCIRILSP+EVQQMGEEGMQLLNS Q INGS Sbjct: 881 DDPWEEFVGCVRCIRILSPTEVQQMGEEGMQLLNSAGLQSINGS 924 >gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prunus persica] Length = 954 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 2/49 (4%) Frame = -1 Query: 395 DDPWEEFVGCVRCIRILSPSEVQQMGEEGMQLLNSTAAQGING--SEGG 255 DDPWEEFVGCVRCIRILSP+EVQQM EEG++LLNS A QGING SEGG Sbjct: 904 DDPWEEFVGCVRCIRILSPTEVQQMSEEGIKLLNSAAMQGINGTMSEGG 952 >ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isoform 2 [Vitis vinifera] Length = 947 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 395 DDPWEEFVGCVRCIRILSPSEVQQMGEEGMQLLNSTAAQGINGS 264 DDPW+EFVGCVRCIRILSPSEVQQM EEGMQLLNSTA +GIN S Sbjct: 901 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 944 >ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isoform 1 [Vitis vinifera] Length = 925 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 395 DDPWEEFVGCVRCIRILSPSEVQQMGEEGMQLLNSTAAQGINGS 264 DDPW+EFVGCVRCIRILSPSEVQQM EEGMQLLNSTA +GIN S Sbjct: 879 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 922 >emb|CBI19831.3| unnamed protein product [Vitis vinifera] Length = 907 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 395 DDPWEEFVGCVRCIRILSPSEVQQMGEEGMQLLNSTAAQGINGS 264 DDPW+EFVGCVRCIRILSPSEVQQM EEGMQLLNSTA +GIN S Sbjct: 861 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 904