BLASTX nr result
ID: Angelica23_contig00021177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00021177 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56221.1| hypothetical protein [Cicer arietinum] 68 7e-10 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -1 Query: 143 VF*REWYIIRKDQVLEVLRISSSFYYLVASTACFLHIMNIQVIAERE 3 VF +WY+I Q+ ++LRIS SFYYLVAS+ACF+HIM IQV+AERE Sbjct: 1 VFLPDWYVISNHQLWKILRISCSFYYLVASSACFVHIMKIQVLAERE 47