BLASTX nr result
ID: Angelica23_contig00020986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020986 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511526.1| isochorismate synthase, putative [Ricinus co... 58 7e-07 ref|XP_003522193.1| PREDICTED: isochorismate synthase, chloropla... 58 9e-07 ref|XP_003516902.1| PREDICTED: isochorismate synthase, chloropla... 58 9e-07 gb|ACX46384.1| isochorismate synthase [Populus tremuloides] 58 9e-07 gb|AAW67000.1| isochorismate synthase protein [Nicotiana tabacum] 57 1e-06 >ref|XP_002511526.1| isochorismate synthase, putative [Ricinus communis] gi|223550641|gb|EEF52128.1| isochorismate synthase, putative [Ricinus communis] Length = 556 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +3 Query: 222 EAVCAKVLIKPNKAIRKL*RAQHLYAHLTGRLKSEDDE 335 EA+C++V+I+PNKAIRK R QHLYA L+G L+SEDDE Sbjct: 416 EAMCSRVVIEPNKAIRKFSRVQHLYAQLSGTLRSEDDE 453 >ref|XP_003522193.1| PREDICTED: isochorismate synthase, chloroplastic-like [Glycine max] Length = 563 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 222 EAVCAKVLIKPNKAIRKL*RAQHLYAHLTGRLKSEDDE 335 EAVC KV+IKP K IRKL R QHLY+ L+GRL+SE+DE Sbjct: 416 EAVCEKVVIKPEKMIRKLSRIQHLYSQLSGRLRSEEDE 453 >ref|XP_003516902.1| PREDICTED: isochorismate synthase, chloroplastic-like [Glycine max] Length = 563 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 222 EAVCAKVLIKPNKAIRKL*RAQHLYAHLTGRLKSEDDE 335 EAVC KV+IKP K IRKL R QHLY+ L+GRL+SE+DE Sbjct: 416 EAVCEKVVIKPEKMIRKLPRIQHLYSQLSGRLRSEEDE 453 >gb|ACX46384.1| isochorismate synthase [Populus tremuloides] Length = 572 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 222 EAVCAKVLIKPNKAIRKL*RAQHLYAHLTGRLKSEDDE 335 EAVC +++++PNKAIRK R QHLYA L G+L+SEDDE Sbjct: 421 EAVCDRIVVEPNKAIRKFHRVQHLYARLAGQLRSEDDE 458 >gb|AAW67000.1| isochorismate synthase protein [Nicotiana tabacum] Length = 302 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 222 EAVCAKVLIKPNKAIRKL*RAQHLYAHLTGRLKSEDDE 335 EAVC+ VLI+P KAIRK R QHLYA L GRL++EDDE Sbjct: 196 EAVCSSVLIEPKKAIRKFPRVQHLYAQLRGRLQTEDDE 233