BLASTX nr result
ID: Angelica23_contig00020971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020971 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524267.1| DAG protein, chloroplast precursor, putative... 109 3e-22 ref|XP_002882907.1| hypothetical protein ARALYDRAFT_478926 [Arab... 109 4e-22 emb|CBI20208.3| unnamed protein product [Vitis vinifera] 108 1e-21 ref|XP_002285388.1| PREDICTED: uncharacterized protein At3g15000... 108 1e-21 dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] 106 4e-21 >ref|XP_002524267.1| DAG protein, chloroplast precursor, putative [Ricinus communis] gi|223536458|gb|EEF38106.1| DAG protein, chloroplast precursor, putative [Ricinus communis] Length = 389 Score = 109 bits (273), Expect = 3e-22 Identities = 51/72 (70%), Positives = 58/72 (80%) Frame = -1 Query: 605 SEQEARMKLYSVSTKYYYAFGALISEELASKFKDMPNVTQVLPDCYKVAKGKDYGGESFI 426 SE+EARMK+YSVST+ YYAFGAL+SEEL+ K K++P V VLPD Y K KDYGGE FI Sbjct: 128 SEEEARMKIYSVSTRCYYAFGALVSEELSYKIKELPRVRWVLPDSYLDVKNKDYGGEPFI 187 Query: 425 DGKPVPYDPMYH 390 DGK VPYDP YH Sbjct: 188 DGKAVPYDPKYH 199 >ref|XP_002882907.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. lyrata] gi|297328747|gb|EFH59166.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. lyrata] Length = 396 Score = 109 bits (272), Expect = 4e-22 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = -1 Query: 605 SEQEARMKLYSVSTKYYYAFGALISEELASKFKDMPNVTQVLPDCYKVAKGKDYGGESFI 426 SE EARMK+YSVST+ YYAFGAL+SE+L+ K K++PNV VLPD Y + KDYGGE FI Sbjct: 130 SEDEARMKIYSVSTRCYYAFGALVSEDLSHKLKELPNVRWVLPDSYLDVRNKDYGGEPFI 189 Query: 425 DGKPVPYDPMYH 390 DGK VPYDP YH Sbjct: 190 DGKAVPYDPKYH 201 >emb|CBI20208.3| unnamed protein product [Vitis vinifera] Length = 229 Score = 108 bits (269), Expect = 1e-21 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = -1 Query: 605 SEQEARMKLYSVSTKYYYAFGALISEELASKFKDMPNVTQVLPDCYKVAKGKDYGGESFI 426 SE+EARMK+YSVST+ Y+AFGAL+SEEL+ K K++P V VLPD Y K KDYGGE FI Sbjct: 27 SEEEARMKIYSVSTRCYFAFGALVSEELSLKIKELPRVRWVLPDSYLDVKNKDYGGEPFI 86 Query: 425 DGKPVPYDPMYH 390 DGK VPYDP YH Sbjct: 87 DGKAVPYDPKYH 98 >ref|XP_002285388.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Vitis vinifera] Length = 421 Score = 108 bits (269), Expect = 1e-21 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = -1 Query: 605 SEQEARMKLYSVSTKYYYAFGALISEELASKFKDMPNVTQVLPDCYKVAKGKDYGGESFI 426 SE+EARMK+YSVST+ Y+AFGAL+SEEL+ K K++P V VLPD Y K KDYGGE FI Sbjct: 129 SEEEARMKIYSVSTRCYFAFGALVSEELSLKIKELPRVRWVLPDSYLDVKNKDYGGEPFI 188 Query: 425 DGKPVPYDPMYH 390 DGK VPYDP YH Sbjct: 189 DGKAVPYDPKYH 200 >dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 415 Score = 106 bits (264), Expect = 4e-21 Identities = 48/72 (66%), Positives = 58/72 (80%) Frame = -1 Query: 605 SEQEARMKLYSVSTKYYYAFGALISEELASKFKDMPNVTQVLPDCYKVAKGKDYGGESFI 426 SE EARMK+YSVST++Y+AFGAL+SEEL+ K K++P V VLPD Y + KDYGGE FI Sbjct: 123 SEDEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEPFI 182 Query: 425 DGKPVPYDPMYH 390 DG+ VPYDP YH Sbjct: 183 DGQAVPYDPKYH 194