BLASTX nr result
ID: Angelica23_contig00020960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020960 (1112 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001189998.1| uncharacterized protein [Arabidopsis thalian... 70 1e-09 ref|XP_002877157.1| hypothetical protein ARALYDRAFT_905203 [Arab... 70 1e-09 ref|NP_189557.2| uncharacterized protein [Arabidopsis thaliana] ... 70 1e-09 ref|XP_004150679.1| PREDICTED: kxDL motif-containing protein CG1... 68 4e-09 ref|XP_004150678.1| PREDICTED: kxDL motif-containing protein CG1... 68 4e-09 >ref|NP_001189998.1| uncharacterized protein [Arabidopsis thaliana] gi|332644018|gb|AEE77539.1| uncharacterized protein [Arabidopsis thaliana] Length = 168 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +2 Query: 644 KYNFVYVFLNLRSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 778 K + Y+FL LRS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 124 KADLDYIFLKLRSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 168 >ref|XP_002877157.1| hypothetical protein ARALYDRAFT_905203 [Arabidopsis lyrata subsp. lyrata] gi|297322995|gb|EFH53416.1| hypothetical protein ARALYDRAFT_905203 [Arabidopsis lyrata subsp. lyrata] Length = 119 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +2 Query: 644 KYNFVYVFLNLRSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 778 K + Y+FL LRS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 75 KADLDYIFLKLRSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >ref|NP_189557.2| uncharacterized protein [Arabidopsis thaliana] gi|9294033|dbj|BAB01990.1| unnamed protein product [Arabidopsis thaliana] gi|332644017|gb|AEE77538.1| uncharacterized protein [Arabidopsis thaliana] Length = 119 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +2 Query: 644 KYNFVYVFLNLRSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 778 K + Y+FL LRS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 75 KADLDYIFLKLRSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >ref|XP_004150679.1| PREDICTED: kxDL motif-containing protein CG10681-like isoform 2 [Cucumis sativus] gi|449503012|ref|XP_004161806.1| PREDICTED: kxDL motif-containing protein CG10681-like isoform 2 [Cucumis sativus] Length = 119 Score = 68.2 bits (165), Expect = 4e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +2 Query: 644 KYNFVYVFLNLRSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 778 K + Y+F +RSMK+KI+ATYPDAFPD+S + ALDRRPDLEIP+ Sbjct: 75 KSDLDYIFQKIRSMKSKILATYPDAFPDESTSEALDRRPDLEIPR 119 >ref|XP_004150678.1| PREDICTED: kxDL motif-containing protein CG10681-like isoform 1 [Cucumis sativus] gi|449503008|ref|XP_004161805.1| PREDICTED: kxDL motif-containing protein CG10681-like isoform 1 [Cucumis sativus] Length = 124 Score = 68.2 bits (165), Expect = 4e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +2 Query: 644 KYNFVYVFLNLRSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 778 K + Y+F +RSMK+KI+ATYPDAFPD+S + ALDRRPDLEIP+ Sbjct: 80 KSDLDYIFQKIRSMKSKILATYPDAFPDESTSEALDRRPDLEIPR 124