BLASTX nr result
ID: Angelica23_contig00020935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020935 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531759.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis] gi|223528595|gb|EEF30615.1| conserved hypothetical protein [Ricinus communis] Length = 163 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/74 (39%), Positives = 44/74 (59%) Frame = -3 Query: 224 ISQVLRWDKC*GLKDVLLESDSQLLVQELQRQDELDSIFGLIVDDCKILLKDLGNCIVSY 45 I + L W + L +V+ E D +V+ L R+ S GLI+ DCK+L + NC ++ Sbjct: 86 IQEALSWARDRQLLNVVFELDCLHIVEALLRKGTDRSSLGLIIKDCKLLSSSISNCSFAF 145 Query: 44 IKRSANQVAHVLAK 3 +KRS N+VAH LA+ Sbjct: 146 VKRSRNEVAHKLAR 159