BLASTX nr result
ID: Angelica23_contig00020697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020697 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519198.1| calmodulin-binding transcription activator (... 57 1e-06 ref|XP_003609751.1| Calmodulin-binding transcription activator [... 55 6e-06 >ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Length = 918 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 134 MEGAVPVRLVGSEIHGFHTMADLDIGNITEEAKSRW 241 ME ++P RLVGS+IHGFHT+ DLD GNI EA SRW Sbjct: 1 MESSLPGRLVGSDIHGFHTLQDLDFGNIMAEATSRW 36 >ref|XP_003609751.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355510806|gb|AES91948.1| Calmodulin-binding transcription activator [Medicago truncatula] Length = 920 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +2 Query: 134 MEGAVPVRLVGSEIHGFHTMADLDIGNITEEAKSRW 241 M +P +LVGSEIHGFHT+ DLD+ +ITEEA++RW Sbjct: 1 MANNLPGQLVGSEIHGFHTLQDLDVASITEEARTRW 36