BLASTX nr result
ID: Angelica23_contig00020692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020692 (775 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arab... 63 8e-09 ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] ... 60 4e-08 ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|... 60 4e-08 ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago ... 55 8e-08 ref|XP_002521418.1| nucleic acid binding protein, putative [Rici... 59 1e-07 >ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] gi|297315712|gb|EFH46135.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 62.8 bits (151), Expect(2) = 8e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 338 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 433 VVRP VTC+ KGPCYGKKLRCP+KCF S+SRS Sbjct: 75 VVRPTVTCREKGPCYGKKLRCPAKCFKSFSRS 106 Score = 23.5 bits (49), Expect(2) = 8e-09 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 499 DCKKKCTASC 528 DCKKKC A C Sbjct: 122 DCKKKCIAYC 131 >ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] gi|332659082|gb|AEE84482.1| glycine-rich protein [Arabidopsis thaliana] Length = 98 Score = 60.5 bits (145), Expect(2) = 4e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 338 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 433 VVRP VTCK KGPC GKKLRCP+KCF S+SRS Sbjct: 42 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRS 73 Score = 23.5 bits (49), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 499 DCKKKCTASC 528 DCKKKC A C Sbjct: 89 DCKKKCIAYC 98 >ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|13507541|gb|AAK28633.1|AF360336_1 unknown protein [Arabidopsis thaliana] gi|4455270|emb|CAB36806.1| putative protein [Arabidopsis thaliana] gi|7268959|emb|CAB81269.1| putative protein [Arabidopsis thaliana] gi|15293275|gb|AAK93748.1| unknown protein [Arabidopsis thaliana] gi|16648720|gb|AAL25552.1| AT4g21620/F17L22_80 [Arabidopsis thaliana] gi|21553868|gb|AAM62961.1| unknown [Arabidopsis thaliana] gi|110742179|dbj|BAE99017.1| hypothetical protein [Arabidopsis thaliana] gi|332659081|gb|AEE84481.1| glycine-rich protein [Arabidopsis thaliana] Length = 131 Score = 60.5 bits (145), Expect(2) = 4e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 338 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 433 VVRP VTCK KGPC GKKLRCP+KCF S+SRS Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRS 106 Score = 23.5 bits (49), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 499 DCKKKCTASC 528 DCKKKC A C Sbjct: 122 DCKKKCIAYC 131 >ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago truncatula] gi|355509244|gb|AES90386.1| hypothetical protein MTR_4g090520 [Medicago truncatula] Length = 138 Score = 54.7 bits (130), Expect(2) = 8e-08 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +2 Query: 338 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 433 V+RP V CK +GPCY KK+ CP++CFTS+SRS Sbjct: 82 VIRPTVVCKDRGPCYQKKVTCPARCFTSFSRS 113 Score = 28.1 bits (61), Expect(2) = 8e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 499 DCKKKCTASC 528 DCKKKCTASC Sbjct: 129 DCKKKCTASC 138 >ref|XP_002521418.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539317|gb|EEF40908.1| nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 338 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 433 ++RP V CK KGPCY KKL CP+KCFTS+SRS Sbjct: 91 IIRPTVVCKEKGPCYKKKLTCPAKCFTSYSRS 122 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 499 DCKKKCTASC 528 DCKKKC A C Sbjct: 138 DCKKKCIAYC 147